BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E01 (472 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces ... 29 0.47 SPAC56E4.03 |||aromatic aminotransferase |Schizosaccharomyces po... 28 0.62 SPAC6B12.09 |trm10||tRNA m|Schizosaccharomyces pombe|chr 1|||Manual 27 1.9 SPAC6G9.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 1.9 SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosacch... 27 1.9 SPBC1773.13 |||aromatic aminotransferase |Schizosaccharomyces po... 25 4.4 SPAC27E2.03c |||GTP binding protein |Schizosaccharomyces pombe|c... 25 5.8 SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces p... 25 7.7 SPCC569.07 |||aromatic aminotransferase |Schizosaccharomyces pom... 25 7.7 >SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 528 Score = 28.7 bits (61), Expect = 0.47 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +2 Query: 119 KVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVE 241 K L + + + YYK+ K Y +AN D K VE Sbjct: 89 KTLGVSKSASASEIKSAYYKLAKQYHPDANPDKAAQDKFVE 129 >SPAC56E4.03 |||aromatic aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 28.3 bits (60), Expect = 0.62 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 4/53 (7%) Frame = +2 Query: 104 VERQKKVLSLFQDVDQVNVDDE-YYKIGKD-YD--VEANIDNYTNKKAVEEFL 250 VER+K++ +L Q D + ++DE YY + D Y+ EA +TN++ V+E + Sbjct: 225 VERRKQIYTLAQKHDIIILEDEPYYYLQMDAYEGKPEAADKAFTNEQFVKELI 277 >SPAC6B12.09 |trm10||tRNA m|Schizosaccharomyces pombe|chr 1|||Manual Length = 304 Score = 26.6 bits (56), Expect = 1.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 272 DNRFCTISRILQQLSYWCSYRCW 204 D + T++++ + LS W YR W Sbjct: 239 DRKILTVNQVFEILSLWLEYRDW 261 >SPAC6G9.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 132 Score = 26.6 bits (56), Expect = 1.9 Identities = 16/72 (22%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = +2 Query: 2 KTVLVLAGLIALVQSSVVSPKTYHFKTKDVDAVFVERQKKV----LSLFQDVDQVNVDDE 169 K ++ A +I +++ + +H +D V + QK+ S D D+ V DE Sbjct: 28 KLIMKFADMIKNARNNEDNEDNHHINYEDESDVGTDEQKQQEGVNSSAVSDTDESAVSDE 87 Query: 170 YYKIGKDYDVEA 205 + +I +++ ++A Sbjct: 88 FMQIKEEFPMKA 99 >SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1031 Score = 26.6 bits (56), Expect = 1.9 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 137 QDVDQVNVDDEYYKIGKDYDVEANIDN 217 Q+V Q+N +DEY + + D EA IDN Sbjct: 55 QNVMQMNFEDEYSEFSNE-DDEAEIDN 80 >SPBC1773.13 |||aromatic aminotransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 481 Score = 25.4 bits (53), Expect = 4.4 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +2 Query: 104 VERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLK 253 + R+KK+L+L + D + V+DE Y + D +++ K FLK Sbjct: 224 LSRRKKLLALARKYDIIIVEDEPYYFLQMEDYNGSLNPAQQKCDGSTFLK 273 >SPAC27E2.03c |||GTP binding protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 392 Score = 25.0 bits (52), Expect = 5.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 200 EANIDNYTNKKAVEEFLKLYRIGYLPK 280 E + N+T ++A+EE KL LPK Sbjct: 270 EERLTNFTEEEAIEECKKLNTKSMLPK 296 >SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 723 Score = 24.6 bits (51), Expect = 7.7 Identities = 24/95 (25%), Positives = 39/95 (41%), Gaps = 2/95 (2%) Frame = +2 Query: 110 RQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEF-LKLYRIGYLPKYY 286 RQ+K LSL D+DQ + ++ + NY + V F L+ GY YY Sbjct: 160 RQEKRLSLIVDLDQTIIHATVDPTVGEWMSDPGNVNYDVLRDVRSFNLQEGPSGYTSCYY 219 Query: 287 -EFSIFYQKLREEAIALFHLFYYAKDFETFYKSAA 388 +F + ++ L+ L Y + + K A Sbjct: 220 IKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVA 254 >SPCC569.07 |||aromatic aminotransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 470 Score = 24.6 bits (51), Expect = 7.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 104 VERQKKVLSLFQDVDQVNVDDEYY 175 +ER+KK L+L + D + V+DE Y Sbjct: 221 LERRKKFLTLAKKYDIIIVEDEPY 244 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,874,252 Number of Sequences: 5004 Number of extensions: 35661 Number of successful extensions: 124 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 180421690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -