BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_D22 (384 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 25 0.23 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 25 0.23 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 25 0.23 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 24 0.53 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 24 0.53 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 24 0.53 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 24 0.53 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 23 0.93 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 0.93 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 23 1.6 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 2.8 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 3.7 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 4.9 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 20 8.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 20 8.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 20 8.6 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.4 bits (53), Expect = 0.23 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +2 Query: 233 KMCQYNLIIKIKLFY*HNNYALKLIYISSYINQFFIVNFLFYFVI*PIP 379 K ++ +I + Y +NN K +Y ++Y ++ +N++ I P+P Sbjct: 75 KSKEHKIISSLSNNYNYNNNNYKKLYCNNYKKLYYNINYIEQIPI-PVP 122 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.4 bits (53), Expect = 0.23 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +2 Query: 233 KMCQYNLIIKIKLFY*HNNYALKLIYISSYINQFFIVNFLFYFVI*PIP 379 K ++ +I + Y +NN K +Y ++Y ++ +N++ I P+P Sbjct: 75 KSKEHKIISSLSNNYNYNNNNYKKLYCNNYKKLYYNINYIEQIPI-PVP 122 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.4 bits (53), Expect = 0.23 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +2 Query: 233 KMCQYNLIIKIKLFY*HNNYALKLIYISSYINQFFIVNFLFYFVI*PIP 379 K ++ +I + Y +NN K +Y ++Y ++ +N++ I P+P Sbjct: 75 KSKEHKIISSLSNNYNYNNNNYKKLYCNNYRKLYYNINYIEQIPI-PVP 122 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 0.53 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 266 KLFY*HNNYALKLIYISSYINQFFIVNFLFYFVI*PIP 379 K Y +NNY KL Y +YI Q I ++Y P P Sbjct: 96 KYNYNNNNYNKKLYYNINYIEQIPIPVPVYYGNFLPRP 133 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 0.53 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 266 KLFY*HNNYALKLIYISSYINQFFIVNFLFYFVI*PIP 379 K Y +NNY KL Y +YI Q I ++Y P P Sbjct: 96 KYNYNNNNYNKKLYYNINYIEQIPIPVPVYYGNFLPRP 133 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 0.53 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 266 KLFY*HNNYALKLIYISSYINQFFIVNFLFYFVI*PIP 379 K Y +NNY KL Y +YI Q I ++Y P P Sbjct: 96 KYNYNNNNYNKKLYYNINYIEQIPIPVPVYYGNFLPRP 133 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 0.53 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 266 KLFY*HNNYALKLIYISSYINQFFIVNFLFYFVI*PIP 379 K Y +NNY KL Y +YI Q I ++Y P P Sbjct: 96 KYNYNNNNYNKKLYYNINYIEQIPIPVPVYYGNFLPRP 133 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.4 bits (48), Expect = 0.93 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 248 NLIIKIKLFY*HNNYALKLIYISSYINQ 331 N I I + +NNY KL Y +YI Q Sbjct: 88 NYISNISNYNNNNNYNKKLYYNINYIEQ 115 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.4 bits (48), Expect = 0.93 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 248 NLIIKIKLFY*HNNYALKLIYISSYINQ 331 N I I + +NNY KL Y +YI Q Sbjct: 326 NYISNISNYNNNNNYNKKLYYNINYIEQ 353 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.6 bits (46), Expect = 1.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 248 NLIIKIKLFY*HNNYALKLIYISSYINQ 331 N I I + NNY KL Y +YI Q Sbjct: 88 NYISNISNYNNDNNYNKKLYYNINYIEQ 115 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 2.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 281 HNNYALKLIYISSYINQ 331 +NNY KL Y +YI Q Sbjct: 101 YNNYNKKLYYNINYIEQ 117 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 3.7 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 275 Y*HNNYALKLIYISSYINQFFIVNFLFYFVI*PIP 379 Y +NN KL Y +YI Q I ++Y P P Sbjct: 98 YNYNNNCKKLYYNINYIEQIPIPVPVYYGNFPPRP 132 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.0 bits (42), Expect = 4.9 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -2 Query: 134 NVFDYCEIIFAPCIYLEIRH 75 N F+Y + C L +RH Sbjct: 205 NAFEYAMAVMKMCDILHLRH 224 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 8.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 281 HNNYALKLIYISSYINQFFIVNFLFYFVI*PIP 379 +NN KL Y +YI Q I ++Y P P Sbjct: 105 YNNNCKKLYYNINYIEQIPIPVPVYYGNFPPRP 137 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 8.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 281 HNNYALKLIYISSYINQFFIVNFLFYFVI*PIP 379 +NN KL Y +YI Q I ++Y P P Sbjct: 105 YNNNCKKLYYNINYIEQIPIPVPVYYGNFPPRP 137 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 8.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 281 HNNYALKLIYISSYINQFFIVNFLFYFVI*PIP 379 +NN KL Y +YI Q I ++Y P P Sbjct: 105 YNNNCKKLYYNINYIEQIPIPVPVYYGNFPPRP 137 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,965 Number of Sequences: 438 Number of extensions: 2026 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9424380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -