BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_D21 (606 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) 29 2.9 SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_49621| Best HMM Match : 7tm_1 (HMM E-Value=6e-12) 27 8.9 SB_22838| Best HMM Match : Arrestin_N (HMM E-Value=1.1e-30) 27 8.9 >SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) Length = 869 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +3 Query: 273 LSIAVAKYITISTNN*QHVITS-SVLQTAWVPYLNSLGTRLLR 398 + +A AKYI +S + + VI + S + +PY NS+ T +LR Sbjct: 165 IQLAEAKYINVSLHFLEQVIVALSEKSRSHIPYRNSMMTSVLR 207 >SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1436 Score = 27.9 bits (59), Expect = 6.7 Identities = 19/72 (26%), Positives = 34/72 (47%) Frame = +2 Query: 83 AINYGIVKEEEQYVYYANYSNTFLYNNEEQRLTYLTEDIGFNSYYYYFHSHLPFWWSSER 262 A+ + I ++ Y+YYA + YNN LTY+ N+ + + + L ++ Sbjct: 822 ALKWAITEKFRDYLYYAPSFTVYTYNNP---LTYILTTAKLNATGHRWVAEL-----ADY 873 Query: 263 YGNLKHRRGEIY 298 +K+R G IY Sbjct: 874 NFTIKYRPGRIY 885 >SB_49621| Best HMM Match : 7tm_1 (HMM E-Value=6e-12) Length = 316 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 Query: 145 VGIVGVIHILLFLFYNSIINSLCIVKNTV 59 VG + + +ILLF +I ++C+V NTV Sbjct: 168 VGFLALNNILLFKVVGCVIITICLVLNTV 196 >SB_22838| Best HMM Match : Arrestin_N (HMM E-Value=1.1e-30) Length = 173 Score = 27.5 bits (58), Expect = 8.9 Identities = 13/56 (23%), Positives = 20/56 (35%) Frame = +2 Query: 176 LTYLTEDIGFNSYYYYFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYYFER 343 + Y E + F S + FH W H+ E+Y+N L + R Sbjct: 29 VVYSKESLKFRSVHVEFHGEARTNWDEMENYTTTHKNEEVYFNKKTSLLANVHLYR 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,573,886 Number of Sequences: 59808 Number of extensions: 381703 Number of successful extensions: 892 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -