BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_D14 (599 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_3920| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_28536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 448 KGLWLSRGLTNLEVVWVTSLNLIFGSRIHC 359 KG + +G+ N ++ V S I+G R+HC Sbjct: 436 KGFFNKQGMFNFALLMVCSPGDIYGKRLHC 465 >SB_3920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 479 ISDLTFDGNTERLVVESWFDEP*SC 405 I + DG ++ V SWFD+P C Sbjct: 97 IVPVEIDGTVHQIPVTSWFDDPNDC 121 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,484,567 Number of Sequences: 59808 Number of extensions: 362715 Number of successful extensions: 844 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 844 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -