BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_D13 (577 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57277| Best HMM Match : Phage_T7_Capsid (HMM E-Value=6.7) 102 2e-22 SB_8675| Best HMM Match : Aminotran_1_2 (HMM E-Value=0) 87 1e-17 SB_51759| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_47095| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 29 2.7 SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) 29 2.7 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_21448| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_47585| Best HMM Match : Umbravirus_LDM (HMM E-Value=1.7) 28 6.3 SB_32989| Best HMM Match : Umbravirus_LDM (HMM E-Value=3.4) 28 6.3 SB_22460| Best HMM Match : CCT (HMM E-Value=4.4) 28 6.3 SB_20004| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_7499| Best HMM Match : zf-CCHC (HMM E-Value=0.00029) 28 6.3 SB_27922| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_57277| Best HMM Match : Phage_T7_Capsid (HMM E-Value=6.7) Length = 130 Score = 102 bits (244), Expect = 2e-22 Identities = 45/67 (67%), Positives = 55/67 (82%) Frame = +2 Query: 77 YFVGCTALRASSTWWSNVPMGPPDVILGITEAYKKDTHPNKVNLGVGAYRDDEGKPFVLP 256 Y G A+R SS WWS+V GPPD ILG+TEA+K+DT+P K+NLGVGAYRDD GKP+VLP Sbjct: 39 YAQGYAAVRLSS-WWSHVEAGPPDAILGVTEAFKRDTNPKKMNLGVGAYRDDTGKPYVLP 97 Query: 257 SVRKAEE 277 SV+KA + Sbjct: 98 SVKKASD 104 >SB_8675| Best HMM Match : Aminotran_1_2 (HMM E-Value=0) Length = 512 Score = 87.0 bits (206), Expect = 1e-17 Identities = 45/103 (43%), Positives = 60/103 (58%), Gaps = 4/103 (3%) Frame = +2 Query: 221 YRDDEGKPFVLPSVRKAEEILHKK----GLNHEYAPISGEAAYTDAVAKLAFGEDSQVIQ 388 YRD++GKP+VLP V K E L + LNHEY I G ++DA KL G D I Sbjct: 106 YRDNDGKPWVLPVVSKVETQLAQGIADGTLNHEYLGIDGLRQFSDAACKLLLGGDHPAIA 165 Query: 389 NKSNCTVQTLSGTGALRLGLEFITNHYAKAKEIWMPTPTWGNH 517 C +Q++SGTG++ LGL+F+ Y K ++ PTWGNH Sbjct: 166 QNRVCGIQSISGTGSVFLGLKFLYQFY-NCKTAYISKPTWGNH 207 Score = 86.2 bits (204), Expect = 2e-17 Identities = 46/102 (45%), Positives = 61/102 (59%), Gaps = 5/102 (4%) Frame = +2 Query: 104 ASSTWWSNVPMGPPDVILGITEAYKKDTHPNKVNLGVGAYRDDEGKPFVLPSVRKAEEIL 283 AS+ + +VP+ P D + + Y KD P+K+NLGVGAYRD++GKP+VLP V K E L Sbjct: 2 ASTNLFKDVPLVPTDHVFHVMACYNKDKDPSKINLGVGAYRDNDGKPWVLPVVSKVETQL 61 Query: 284 HK----KGLNHEYAPISGEAAYTDAVAKLAFGEDSQVI-QNK 394 + LNHEY I G ++DA KL G D I QN+ Sbjct: 62 AQGIADGTLNHEYLGIDGLRQFSDAACKLLLGGDHPAIAQNR 103 >SB_51759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 49.2 bits (112), Expect = 2e-06 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 5/63 (7%) Frame = +2 Query: 221 YRDDEGKPFVLPSVRKAEEILHK----KGLNHEYAPISGEAAYTDAVAKLAFGEDSQVI- 385 YRD++GKP+VLP V K E L + LNHEY I G ++DA KL G D I Sbjct: 2 YRDNDGKPWVLPVVSKVETQLAQGIADGTLNHEYLGIDGLRQFSDAACKLLLGGDHPAIA 61 Query: 386 QNK 394 QN+ Sbjct: 62 QNR 64 >SB_47095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 29.5 bits (63), Expect = 2.1 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +2 Query: 146 DVILGITEAYKKDTHPNKVNLGVGAYRDDEGKPFVLPSVRKAEEILHKKGLNH 304 DV YK+D + NLGV AYR P +LP + +EI++ KG+ + Sbjct: 84 DVACDSYHKYKEDVQLLR-NLGVKAYRFSISWPRILP--KGTKEIINTKGIEY 133 >SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1227 Score = 29.1 bits (62), Expect = 2.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 455 ITNHYAKAKEIWMPTPTWGNHPQICN 532 +T+ AK +W+ P++GN PQ N Sbjct: 92 VTHRSAKESRLWLSEPSYGNWPQQLN 117 >SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) Length = 999 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 461 NHYAKAKEIWMPTPTWGNHPQICNMLKVATQEVPLLRPQ 577 NH AK +E+ + N+P+ M+++A + + L PQ Sbjct: 433 NHAAKLEEVATLACSMSNNPEKVKMVRIAARHIRALAPQ 471 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 227 DDEGKPFVLPSVRKAEEILHKKGLNHEYAPISGEA 331 D + KP + + +E +H K + H+YA SGE+ Sbjct: 171 DIDQKPTANSKMDEKKEFIHAKYIKHQYAQKSGES 205 >SB_21448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 543 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = -3 Query: 353 WRPHQYMLLHH*SEHIHDLNLFYEESLLPSSLMVRQMVSLHHLCMLQHQG*PCWDVCLSC 174 W + ++H S + +LFY + LL + +++ +M H+ L C C+SC Sbjct: 461 WLLNSSYNIYHFSALLFTTDLFYVKFLLDAFILLWRMPKYRHVVKLVWTRCCCCQCCVSC 520 >SB_47585| Best HMM Match : Umbravirus_LDM (HMM E-Value=1.7) Length = 421 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 275 LLPSSLMVRQMVSLHHLCMLQHQG 204 LLP V Q+V+LHH + HQG Sbjct: 269 LLPRKHHVSQLVALHHHVKVHHQG 292 >SB_32989| Best HMM Match : Umbravirus_LDM (HMM E-Value=3.4) Length = 279 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 275 LLPSSLMVRQMVSLHHLCMLQHQG 204 LLP V Q+V+LHH + HQG Sbjct: 127 LLPRKHHVSQLVALHHHVKVHHQG 150 >SB_22460| Best HMM Match : CCT (HMM E-Value=4.4) Length = 313 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 275 LLPSSLMVRQMVSLHHLCMLQHQG 204 LLP V Q+V+LHH + HQG Sbjct: 161 LLPRKHHVSQLVALHHHVKVHHQG 184 >SB_20004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 275 LLPSSLMVRQMVSLHHLCMLQHQG 204 LLP V Q+V+LHH + HQG Sbjct: 96 LLPRKHHVSQLVALHHHVKVHHQG 119 >SB_7499| Best HMM Match : zf-CCHC (HMM E-Value=0.00029) Length = 846 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 275 LLPSSLMVRQMVSLHHLCMLQHQG 204 LLP V Q+V+LHH + HQG Sbjct: 479 LLPRKHHVSQLVALHHHIKVHHQG 502 >SB_27922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1704 Score = 27.5 bits (58), Expect = 8.3 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +2 Query: 299 NHEYAPISGEAAY-TDAVAKLAFGEDSQVIQNKSNCTVQTLSGTGALRLGLEFITNHYAK 475 +H + S E Y TD E I+N S C + +G+G ++I +HYAK Sbjct: 58 DHIFENYSFEHEYPTDLPITSYHHEIVNTIENNSACVIFGPTGSGKTTQVPQYILDHYAK 117 Query: 476 AK 481 + Sbjct: 118 QR 119 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,713,186 Number of Sequences: 59808 Number of extensions: 441090 Number of successful extensions: 964 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -