BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_D09 (221 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-tran... 69 2e-14 Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein prot... 66 2e-13 AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-tran... 66 2e-13 Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein prot... 65 3e-13 Z71481-1|CAA96105.1| 140|Anopheles gambiae GSTD2 protein protein. 65 3e-13 AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-tran... 65 3e-13 AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-tran... 64 6e-13 AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-tran... 64 6e-13 AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-tran... 64 6e-13 AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-tran... 64 7e-13 AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-tran... 64 7e-13 AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 63 1e-12 AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-tran... 62 2e-12 AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-tran... 62 2e-12 Z71480-1|CAA96104.1| 209|Anopheles gambiae GSTD2 protein protein. 55 3e-10 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 52 2e-09 AY070255-1|AAL59654.1| 230|Anopheles gambiae glutathione S-tran... 52 2e-09 AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranfe... 51 6e-09 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 51 6e-09 AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-tran... 51 6e-09 AF071161-1|AAC79997.1| 218|Anopheles gambiae glutathione S-tran... 50 1e-08 AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-tran... 50 1e-08 AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-tran... 48 5e-08 AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-tran... 48 5e-08 AY070234-1|AAL58538.1| 223|Anopheles gambiae glutathione S-tran... 46 1e-07 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 45 3e-07 AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-tran... 45 4e-07 AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 44 6e-07 AF513638-1|AAM53610.1| 210|Anopheles gambiae glutathione S-tran... 44 6e-07 AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-tran... 42 3e-06 AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-tran... 41 4e-06 AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-tran... 38 4e-05 AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-tran... 34 5e-04 AY063775-1|AAL59657.1| 27|Anopheles gambiae glutathione S-tran... 24 0.73 U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. 23 1.7 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 22 2.9 AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding pr... 21 3.9 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 21 6.8 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 21 6.8 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 21 6.8 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 21 6.8 AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical prote... 20 9.0 >AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-transferase D11 protein. Length = 214 Score = 68.9 bits (161), Expect = 2e-14 Identities = 31/60 (51%), Positives = 38/60 (63%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 +D + S PC ++ L A L L +N VD G HL PE+LK+NPQHTVP LVDNDF Sbjct: 1 MDFYHLPLSAPCQSIRLLAKALGLHLNLKEVDLLKGEHLKPEFLKINPQHTVPTLVDNDF 60 >Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein protein. Length = 209 Score = 65.7 bits (153), Expect = 2e-13 Identities = 27/60 (45%), Positives = 38/60 (63%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 +D + S PC V +TAA + +++N + D G H+ PE+LKLNPQH +P LVDN F Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCIPTLVDNGF 60 >AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 65.7 bits (153), Expect = 2e-13 Identities = 27/60 (45%), Positives = 38/60 (63%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 +D + S PC V +TAA + +++N + D G H+ PE+LKLNPQH +P LVDN F Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCIPTLVDNGF 60 >Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein protein. Length = 209 Score = 64.9 bits (151), Expect = 3e-13 Identities = 26/60 (43%), Positives = 38/60 (63%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 +D + S PC V +TAA + +++N + D G H+ PE+LK+NPQH +P LVDN F Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKINPQHCIPTLVDNGF 60 >Z71481-1|CAA96105.1| 140|Anopheles gambiae GSTD2 protein protein. Length = 140 Score = 64.9 bits (151), Expect = 3e-13 Identities = 27/60 (45%), Positives = 37/60 (61%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 +D + S PC V +TAA + ++N + D G H+ PE+LKLNPQH +P LVDN F Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGAELNLKLTDLMKGEHMKPEFLKLNPQHCIPTLVDNGF 60 >AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 64.9 bits (151), Expect = 3e-13 Identities = 26/60 (43%), Positives = 38/60 (63%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 +D + S PC V +TAA + +++N + D G H+ PE+LK+NPQH +P LVDN F Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKINPQHCIPTLVDNGF 60 >AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-transferase E2 protein. Length = 221 Score = 64.1 bits (149), Expect = 6e-13 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDN 211 L ++ SPPC V LTA L L++ + ++ G HL PE++KLNPQHT+P+L DN Sbjct: 4 LVLYTLHLSPPCRAVELTAKALGLELEQKTINLLTGDHLKPEFVKLNPQHTIPVLDDN 61 >AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-transferase D1-4 protein. Length = 216 Score = 64.1 bits (149), Expect = 6e-13 Identities = 27/60 (45%), Positives = 38/60 (63%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 +D + S PC V +TAA + +++N + D G H+ PE+LKLNPQH VP LVD+ F Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCVPTLVDSGF 60 >AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-transferase protein. Length = 216 Score = 64.1 bits (149), Expect = 6e-13 Identities = 27/60 (45%), Positives = 38/60 (63%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 +D + S PC V +TAA + +++N + D G H+ PE+LKLNPQH VP LVD+ F Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCVPTLVDSGF 60 >AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-transferase D1-3 protein. Length = 218 Score = 63.7 bits (148), Expect = 7e-13 Identities = 26/59 (44%), Positives = 37/59 (62%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDND 214 +D + S PC V +TAA + +++N + D G H+ PE+LKLNPQH +P LVD D Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCIPTLVDED 59 >AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 63.7 bits (148), Expect = 7e-13 Identities = 26/59 (44%), Positives = 37/59 (62%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDND 214 +D + S PC V +TAA + +++N + D G H+ PE+LKLNPQH +P LVD D Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCIPTLVDED 59 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 63.3 bits (147), Expect = 1e-12 Identities = 30/59 (50%), Positives = 37/59 (62%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDND 214 LD++ SPPC VLL A L L++N I +D H PE+LKLNPQH +P LVD D Sbjct: 4 LDLYYNIISPPCRVVLLFAKWLKLELNLIELDVLKRDHYKPEFLKLNPQHYIPTLVDAD 62 >AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 62.1 bits (144), Expect = 2e-12 Identities = 26/56 (46%), Positives = 39/56 (69%) Frame = +2 Query: 44 IHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDN 211 ++ SPPC V LTA L L++ + +V+ G +L+PE+LKLNP+HT+P+L DN Sbjct: 6 LYTVRLSPPCRAVELTAKALGLELERKLVNLLAGQNLTPEFLKLNPKHTIPVLDDN 61 >AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 62.1 bits (144), Expect = 2e-12 Identities = 26/56 (46%), Positives = 39/56 (69%) Frame = +2 Query: 44 IHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDN 211 ++ SPPC V LTA L L++ + +V+ G +L+PE+LKLNP+HT+P+L DN Sbjct: 6 LYTVHLSPPCRAVELTAKALGLELERKLVNLLAGENLTPEFLKLNPKHTIPVLDDN 61 >Z71480-1|CAA96104.1| 209|Anopheles gambiae GSTD2 protein protein. Length = 209 Score = 55.2 bits (127), Expect = 3e-10 Identities = 24/57 (42%), Positives = 33/57 (57%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVD 208 LD + S PC V + A + +K+N +D G H SP++ KLNPQ T+P LVD Sbjct: 2 LDFYYLPGSAPCRAVQMVAEAVHVKLNLKYLDLMAGAHRSPQFTKLNPQRTIPTLVD 58 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 52.4 bits (120), Expect = 2e-09 Identities = 26/59 (44%), Positives = 32/59 (54%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDND 214 +D + ASP C +V+L A L L +N VD L P + LNP H VP LVDND Sbjct: 1 MDFYYHPASPYCRSVMLVAKALKLSLNLQFVDLMKDEQLRPTFTVLNPFHCVPTLVDND 59 >AY070255-1|AAL59654.1| 230|Anopheles gambiae glutathione S-transferase E5 protein. Length = 230 Score = 52.0 bits (119), Expect = 2e-09 Identities = 21/57 (36%), Positives = 37/57 (64%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVD 208 + ++ + SPP V LTA +L L ++ + ++ G H + E+L+LNPQHT+P++ D Sbjct: 7 IKLYTAKLSPPGRAVELTAKLLGLSLDIVPINLLAGDHRTDEFLRLNPQHTIPVIDD 63 >AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranferase d9 protein. Length = 216 Score = 50.8 bits (116), Expect = 6e-09 Identities = 23/56 (41%), Positives = 33/56 (58%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILV 205 +D++ SPP +LL L LK N I +D +++P + K+NPQHTVP LV Sbjct: 1 MDLYYNILSPPSRAILLLGEALQLKFNLISLDVHRKDYVNPAFKKINPQHTVPTLV 56 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 50.8 bits (116), Expect = 6e-09 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +2 Query: 44 IHVTEASPPCSTVLLTAAILDLK--INKIVVDFANGVHLSPEYLKLNPQHTVPIL 202 ++ E SPP VLL A L +K I +D G HLS +YLK+NP HTVP+L Sbjct: 3 LYYDEVSPPVRGVLLAIAALGVKDRIKLEYIDLFKGGHLSSDYLKINPLHTVPVL 57 >AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-transferase u3 protein. Length = 218 Score = 50.8 bits (116), Expect = 6e-09 Identities = 23/52 (44%), Positives = 31/52 (59%) Frame = +2 Query: 62 SPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 SPP + LL LDL +V+ G HL+ E++ +NP HTVP LVD D+ Sbjct: 12 SPPSRSALLALRNLDLDAEVKIVNLFAGEHLADEFVAINPDHTVPTLVDEDY 63 >AF071161-1|AAC79997.1| 218|Anopheles gambiae glutathione S-transferase D7 protein. Length = 218 Score = 50.0 bits (114), Expect = 1e-08 Identities = 21/60 (35%), Positives = 37/60 (61%) Frame = +2 Query: 32 MTLDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDN 211 MT ++ SPPC +VLL A ++ +++ ++ G L P++++LNPQH +P L D+ Sbjct: 1 MTPVLYYLPPSPPCRSVLLLAKMIGVELELKALNVMEGEQLKPDFVELNPQHCIPTLDDH 60 >AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-transferase E4 protein. Length = 225 Score = 49.6 bits (113), Expect = 1e-08 Identities = 21/58 (36%), Positives = 37/58 (63%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDN 211 + ++ + SPP +V LTA L L+++ + ++ HL+ + KLNPQHT+P++ DN Sbjct: 4 IKLYTAKLSPPGRSVELTAKALGLELDIVPINLLAQEHLTEAFRKLNPQHTIPLIDDN 61 >AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-transferase 3-8 protein. Length = 225 Score = 47.6 bits (108), Expect = 5e-08 Identities = 22/57 (38%), Positives = 33/57 (57%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVD 208 L ++ SPPC V LTA L +++ + + G L E+LK+NPQ T+P+L D Sbjct: 6 LVLYTNRKSPPCRAVKLTARALGIELVEKEMTLLRGDKLMEEFLKVNPQQTIPVLDD 62 >AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-transferase E7 protein. Length = 225 Score = 47.6 bits (108), Expect = 5e-08 Identities = 22/57 (38%), Positives = 33/57 (57%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVD 208 L ++ SPPC V LTA L +++ + + G L E+LK+NPQ T+P+L D Sbjct: 6 LVLYTNRKSPPCRAVKLTARALGIELVEKEMTLLRGDKLMEEFLKVNPQQTIPVLDD 62 >AY070234-1|AAL58538.1| 223|Anopheles gambiae glutathione S-transferase E3 protein. Length = 223 Score = 46.4 bits (105), Expect = 1e-07 Identities = 20/56 (35%), Positives = 35/56 (62%) Frame = +2 Query: 44 IHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDN 211 ++ T +P V LTA ++ ++++ +D A +++ EYLK+NP HTVP + DN Sbjct: 6 LYSTRRTPAGRAVELTAKMIGIELDVQYIDLAKKENMTEEYLKMNPMHTVPTVNDN 61 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 45.2 bits (102), Expect = 3e-07 Identities = 23/58 (39%), Positives = 31/58 (53%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDN 211 +D++ SPPC V+ A L L+ N IV + K+NPQHT+P LVDN Sbjct: 1 MDLYYHIRSPPCQPVVFLARHLGLEFNHIVTSIYDPADFEV-LKKVNPQHTIPTLVDN 57 >AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-transferase u1 protein. Length = 233 Score = 44.8 bits (101), Expect = 4e-07 Identities = 18/60 (30%), Positives = 31/60 (51%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 + ++ PP V + L++ + VD+ HL+ EY K+NPQ +P+L D+ F Sbjct: 1 MKLYAVSDGPPSLAVRMALEALNIPYEHVSVDYGKAEHLTAEYEKMNPQKEIPVLDDDGF 60 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 44.0 bits (99), Expect = 6e-07 Identities = 21/52 (40%), Positives = 31/52 (59%) Frame = +2 Query: 62 SPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 SPP VLL L+L +N V+ G + E++++NP+HT+P L DN F Sbjct: 12 SPPARAVLLLMKELELPMNLKEVNPLAGETRTEEFMRMNPEHTIPTLDDNGF 63 >AF513638-1|AAM53610.1| 210|Anopheles gambiae glutathione S-transferase D3 protein. Length = 210 Score = 44.0 bits (99), Expect = 6e-07 Identities = 22/58 (37%), Positives = 32/58 (55%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDN 211 +D + + SPPC + +L A L + +N + + V KLNPQHT+P LVDN Sbjct: 1 MDYYYSLISPPCQSAILVAKKLGITLNLKKTNIHDPVERDA-LTKLNPQHTIPTLVDN 57 >AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-transferase E6 protein. Length = 227 Score = 41.5 bits (93), Expect = 3e-06 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = +2 Query: 62 SPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDNDF 217 SP V LT L+L ++ ++ G H+S E+ KLNP T+P L DN F Sbjct: 13 SPAGRAVELTVKALNLDVDVREMNVFKGQHMSDEFKKLNPVQTIPTLDDNGF 64 >AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-transferase D4 protein. Length = 212 Score = 41.1 bits (92), Expect = 4e-06 Identities = 21/58 (36%), Positives = 33/58 (56%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDN 211 +D + SPP +V+L A L +K+N ++ + V + KLNP H +P+LVDN Sbjct: 1 MDYYCNFVSPPSQSVILVAKKLGIKLNLRKINIYDPVAMDT-LSKLNPHHILPMLVDN 57 >AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-transferase D5 protein. Length = 216 Score = 37.9 bits (84), Expect = 4e-05 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDND 214 ++++ SP C VLL A L + +N + + ++ E K+NPQH +P V++D Sbjct: 1 MELYSDIVSPSCQNVLLVAKKLGIALNIKKTNIMDATDVA-ELTKVNPQHLIPTFVEDD 58 >AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-transferase D10 protein. Length = 211 Score = 34.3 bits (75), Expect = 5e-04 Identities = 16/58 (27%), Positives = 31/58 (53%) Frame = +2 Query: 38 LDIHVTEASPPCSTVLLTAAILDLKINKIVVDFANGVHLSPEYLKLNPQHTVPILVDN 211 ++++ SPPC +VLL L + + V+ + + + K NPQHT+P +++ Sbjct: 1 MELYYNIVSPPCQSVLLVGKKLGITFDLKEVN-PHLPEVREQLRKFNPQHTIPTFIED 57 >AY063775-1|AAL59657.1| 27|Anopheles gambiae glutathione S-transferase 1-7 protein. Length = 27 Score = 23.8 bits (49), Expect = 0.73 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 32 MTLDIHVTEASPPCSTVLLTAAILDLK 112 MT ++ SPPC +VLL A ++ ++ Sbjct: 1 MTPVLYYLPPSPPCRSVLLLAKMIGVE 27 >U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. Length = 280 Score = 22.6 bits (46), Expect = 1.7 Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = -3 Query: 183 CGLSFKYSGERCTPLAKSTTI-LF---ILRSNIAAVNSTV 76 CG + SGE PLA S +I LF I RS+ AA V Sbjct: 172 CGEVYGTSGELWPPLAVSASITLFPSDICRSHYAASREQV 211 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 21.8 bits (44), Expect = 2.9 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -2 Query: 148 HAVSEIDYDFIYFEVQYCSS*QHGATRRRSFGHVDIQSHLQ 26 HAVS +D+ ++Q+CS + + F + + Q+HL+ Sbjct: 255 HAVSYVDFQDGASQLQFCSDKCLNQYKMQIFCN-ETQAHLE 294 >AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding protein AgamOBP15 protein. Length = 147 Score = 21.4 bits (43), Expect = 3.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 3 DLCYISHV*R*LWIST*PKLRLLVAPC 83 D C ++ W T P+LRL VA C Sbjct: 118 DACERAYSHHRCWKETEPELRLPVAVC 144 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 20.6 bits (41), Expect = 6.8 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 77 CYKEAKLRSRGYPKSSSNVRNV 12 CY+ +RS G+P + V V Sbjct: 45 CYRGPDMRSVGHPMTQLKVLQV 66 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 20.6 bits (41), Expect = 6.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 192 TVCCGLSFKYSGERCTPLAKSTTI 121 T GLS + E TP A T+I Sbjct: 162 TAADGLSMRDENESITPFAPYTSI 185 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 20.6 bits (41), Expect = 6.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 95 QQLTARCYKEAKL 57 QQL++ CY EA L Sbjct: 232 QQLSSPCYMEATL 244 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 20.6 bits (41), Expect = 6.8 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 221 RRNRYPPELGRCVV 180 R+NR E+GRC++ Sbjct: 445 RKNRSLTEMGRCML 458 >AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical protein protein. Length = 135 Score = 20.2 bits (40), Expect = 9.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 10 VTFRTFEDDFGYPRDR 57 +TF T +D+F P +R Sbjct: 93 ITFSTTQDNFPTPHNR 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 244,579 Number of Sequences: 2352 Number of extensions: 4165 Number of successful extensions: 46 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 51 effective length of database: 444,027 effective search space used: 9768594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -