BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_D06 (502 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 1.4 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 1.4 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 25 1.9 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 25 1.9 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 25 1.9 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 4.4 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 4.4 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 4.4 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 23 5.8 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 23 7.7 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 23 7.7 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.0 bits (52), Expect = 1.4 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 60 YNQMPFHPEHHHNRLRSP 113 ++Q+P HP H H+ + P Sbjct: 100 HHQLPHHPHHQHHPQQQP 117 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.0 bits (52), Expect = 1.4 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 60 YNQMPFHPEHHHNRLRSP 113 ++Q+P HP H H+ + P Sbjct: 100 HHQLPHHPHHQHHPQQQP 117 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.6 bits (51), Expect = 1.9 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = +3 Query: 78 HPEHHHNRLRSPY----FGEDVFDTGRFWSELS 164 H HHH R R Y FG ++ + F S+ S Sbjct: 30 HSRHHHRRRRERYRSQRFGYEIQNVDEFLSKCS 62 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.6 bits (51), Expect = 1.9 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = +3 Query: 78 HPEHHHNRLRSPY----FGEDVFDTGRFWSELS 164 H HHH R R Y FG ++ + F S+ S Sbjct: 30 HSRHHHRRRRERYRSQRFGYEIQNVDEFLSKCS 62 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.6 bits (51), Expect = 1.9 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = +3 Query: 78 HPEHHHNRLRSPY----FGEDVFDTGRFWSELS 164 H HHH R R Y FG ++ + F S+ S Sbjct: 30 HSRHHHRRRRERYRSQRFGYEIQNVDEFLSKCS 62 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 4.4 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 349 KYEGDVQKNYLDVRTLPDCVNVNGSWTYSQGVLKIV 456 +YE D Q L ++ PD N +T +G+L+ V Sbjct: 1881 RYEYDNQSGLLTLKRTPDAGNTRYMYT-PEGLLRFV 1915 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 4.4 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 349 KYEGDVQKNYLDVRTLPDCVNVNGSWTYSQGVLKIV 456 +YE D Q L ++ PD N +T +G+L+ V Sbjct: 1882 RYEYDNQSGLLTLKRTPDAGNTRYMYT-PEGLLRFV 1916 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.4 bits (48), Expect = 4.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 69 MPFHPEHHHNRLRSP 113 +P+H +HHN SP Sbjct: 454 LPYHDHNHHNSPMSP 468 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 306 NDVLLIKGG*KV*SPCIRCLRCLE 235 + V L++ K +RC RCLE Sbjct: 273 HSVCLVRSAPKQQQSAVRCFRCLE 296 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 22.6 bits (46), Expect = 7.7 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +3 Query: 84 EHHHNRLRSPYFGEDVFDTGRFWSELSSE 170 +H R + FG D G +WS +E Sbjct: 29 QHTSRRFKDESFGHDQTPAGSWWSSHLTE 57 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 22.6 bits (46), Expect = 7.7 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +3 Query: 84 EHHHNRLRSPYFGEDVFDTGRFWSELSSE 170 +H R + FG D G +WS +E Sbjct: 29 QHTSRRFKDESFGHDQTPAGSWWSSHLTE 57 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 544,238 Number of Sequences: 2352 Number of extensions: 10866 Number of successful extensions: 38 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -