BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_D05 (566 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 4.2 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 5.6 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 7.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.8 bits (44), Expect = 4.2 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -1 Query: 170 HHGVYKRTSPSGN*HFPLPNGWSPQAS*SH 81 HH + + FPL G SP AS H Sbjct: 24 HHHEQSAAAAAAYRSFPLSLGMSPYASSQH 53 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.4 bits (43), Expect = 5.6 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +2 Query: 104 TTHLGAENVNFQMETYVYKRRGDGT 178 T L N N+ TY+ K G G+ Sbjct: 272 TFTLSNSNTNYNPGTYINKEAGGGS 296 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 7.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 370 VSKCTRSETSSNWC 329 VS C + +SS WC Sbjct: 135 VSSCHQGFSSSTWC 148 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 408 INSLGSRNAAWIWLV 364 +N S AWIWL+ Sbjct: 455 LNDFISHQHAWIWLL 469 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 408 INSLGSRNAAWIWLV 364 +N S AWIWL+ Sbjct: 455 LNDFISHQHAWIWLL 469 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 408 INSLGSRNAAWIWLV 364 +N S AWIWL+ Sbjct: 455 LNDFISHQHAWIWLL 469 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 408 INSLGSRNAAWIWLV 364 +N S AWIWL+ Sbjct: 455 LNDFISHQHAWIWLL 469 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,627 Number of Sequences: 336 Number of extensions: 2550 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13995094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -