BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_D05 (566 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 3.7 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 3.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.6 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -2 Query: 460 DI*SFSNWLMILSRVQNNQQPWFAE 386 +I F +++ L+ N + PWF+E Sbjct: 259 NIPGFDDYMASLTPDTNRRNPWFSE 283 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -2 Query: 460 DI*SFSNWLMILSRVQNNQQPWFAE 386 +I F +++ L+ N + PWF+E Sbjct: 349 NIPGFDDYMASLTPDTNRRNPWFSE 373 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 4.9 Identities = 6/30 (20%), Positives = 16/30 (53%) Frame = +2 Query: 410 VLDPAQDHQPITEASYVNIPVIALCNTDSP 499 ++DP ++++ E + IP++ + P Sbjct: 167 IVDPVEENETYDEFDTIRIPIVRSLSKSPP 196 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 145 LHLEINIFRSQMGGRRKHLSHI 80 LHLE N R G + LSH+ Sbjct: 847 LHLEDNRIRELKGFEFERLSHL 868 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,659 Number of Sequences: 438 Number of extensions: 2892 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -