BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_D01 (468 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 5.3 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 7.0 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 23.0 bits (47), Expect = 5.3 Identities = 10/31 (32%), Positives = 21/31 (67%) Frame = +1 Query: 58 EIITLNSVSIVISILFD*ISLLFIMFVCLIS 150 +II LNS + +SI+F + ++F + + L++ Sbjct: 514 KIIFLNSFKMKLSIIFGVVHMIFGVCMSLVN 544 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 22.6 bits (46), Expect = 7.0 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 58 EIITLNSVSIVISILFD*ISLLFIMFVCLISSVVIYYRKR 177 +II LNS + +SI+F + ++F VC+ +++KR Sbjct: 525 KIIFLNSYKMKLSIIFGVVHMIF--GVCMSVVNHNFFKKR 562 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,982 Number of Sequences: 2352 Number of extensions: 2201 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -