BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_C22 (564 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein si... 56 1e-08 At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein si... 56 2e-08 At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein si... 50 1e-06 At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein si... 49 2e-06 At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein si... 47 1e-05 At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein si... 46 1e-05 At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein si... 45 4e-05 At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein si... 44 9e-05 At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein si... 43 1e-04 At3g16460.2 68416.m02097 jacalin lectin family protein contains ... 31 0.70 At3g16460.1 68416.m02098 jacalin lectin family protein contains ... 31 0.70 At1g30220.1 68414.m03697 sugar transporter family protein simila... 29 1.6 At5g42390.1 68418.m05161 metalloendopeptidase identical to chlor... 29 2.8 At4g34350.1 68417.m04881 LytB family protein contains Pfam profi... 28 3.7 At5g57000.1 68418.m07114 expressed protein similar to unknown pr... 28 5.0 At2g46530.2 68415.m05803 transcriptional factor B3 family protei... 27 6.5 At2g46530.1 68415.m05802 transcriptional factor B3 family protei... 27 6.5 At1g50790.1 68414.m05712 hypothetical protein 27 6.5 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 27 8.7 At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containi... 27 8.7 At2g33570.1 68415.m04114 expressed protein 27 8.7 >At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 332 Score = 56.4 bits (130), Expect = 1e-08 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 1/103 (0%) Frame = +3 Query: 21 KPNMQLVISVL-PNVNSSIYFDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQ 197 KP + L +V +V + + V + +D VNI A+D+Y P + K TA ++ Sbjct: 162 KPTLLLTAAVYYSSVYKTFTYPVQVMRESLDWVNIIAYDFYGPVSSSKFTVPTAGLHVSS 221 Query: 198 NRDPLQNADAAINYWIQNGAPTHKLVLGISTTGRTWKLDSDSE 326 N + + D+ + WI++G P K VLG S G W L +D + Sbjct: 222 NNEG-PSGDSGLKQWIKDGLPEKKAVLGFSYVGWAWTLQNDKD 263 >At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 379 Score = 56.0 bits (129), Expect = 2e-08 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 1/109 (0%) Frame = +3 Query: 21 KPNMQLVISVLPNVNS-SIYFDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQ 197 KP + L +V + N S+ + V ++ + +D VN+ A+D+Y P + + A ++ P Sbjct: 171 KPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWS-RVTGPPAALFDPS 229 Query: 198 NRDPLQNADAAINYWIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPP 344 N P + DA WIQ G P K VLG G W+L + + S P Sbjct: 230 NAGP--SGDAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAP 276 >At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 362 Score = 50.0 bits (114), Expect = 1e-06 Identities = 28/86 (32%), Positives = 47/86 (54%) Frame = +3 Query: 78 FDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQNRDPLQNADAAINYWIQNGA 257 + V +I + +D VNI A+D+Y P +P A ++ P N ++ D+ ++ W++ Sbjct: 179 YPVQAIADNLDFVNIMAYDFYGPGWSPVTGP-PAALFDPSNPAG-RSGDSGLSKWLEAKL 236 Query: 258 PTHKLVLGISTTGRTWKLDSDSEISG 335 P K VLG S G W L+ D+E +G Sbjct: 237 PAKKAVLGFSYCGWAWTLE-DAENNG 261 >At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 366 Score = 49.2 bits (112), Expect = 2e-06 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 1/133 (0%) Frame = +3 Query: 21 KPNMQLVISVLPNVNS-SIYFDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQ 197 KP + L +V + + S+ V ++ + +D VN+ A+D+Y + + AP+Y P Sbjct: 169 KPRLLLTAAVFYSYSYYSVLHPVNAVADSLDWVNLVAYDFYE-SGSSRVTCSPAPLYDPI 227 Query: 198 NRDPLQNADAAINYWIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGP 377 P + DA + W Q G P K VLG G W L +D++ H +GP Sbjct: 228 TTGP--SGDAGVRAWTQAGLPAKKAVLGFPLYGYAWCL-TDAK------NHNYYANSSGP 278 Query: 378 YTKVQGLLSYPEI 416 G + Y +I Sbjct: 279 AISPDGSIGYDQI 291 >At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 289 Score = 46.8 bits (106), Expect = 1e-05 Identities = 29/109 (26%), Positives = 50/109 (45%), Gaps = 2/109 (1%) Frame = +3 Query: 6 QALNVKPNMQLVISVLPNVNSSIYFDVPSIINLVDIVNIQAFDYY--TPERNPKEADYTA 179 Q ++P + + +S+ + V +I +D VN+ A+++Y T E P A Sbjct: 137 QRTGIRPLLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAYEFYGLTTEIGPP-----A 191 Query: 180 PIYAPQNRDPLQNADAAINYWIQNGAPTHKLVLGISTTGRTWKLDSDSE 326 +Y P + P D + +W++ G P K V G G +W LD D + Sbjct: 192 GLYDPSIKGPC--GDTGLKHWLKAGLPEKKAVFGFPYVGWSWTLDDDKD 238 >At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 261 Score = 46.4 bits (105), Expect = 1e-05 Identities = 36/120 (30%), Positives = 49/120 (40%) Frame = +3 Query: 57 NVNSSIYFDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQNRDPLQNADAAIN 236 N N +Y V I L+D VNI+A+D+Y P + T P A + + D+ + Sbjct: 77 NYNGVVY-PVKFISELLDWVNIKAYDFY----GPGCTEVTGPPAALYLQSDGPSGDSGVK 131 Query: 237 YWIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEI 416 WI G P K VLG G W L P H GP G +SY ++ Sbjct: 132 DWIDAGLPAEKAVLGFPYYGWAWTLAD-------PKNHGYYVDTTGPAISDDGEISYSQL 184 >At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 398 Score = 44.8 bits (101), Expect = 4e-05 Identities = 30/113 (26%), Positives = 52/113 (46%) Frame = +3 Query: 78 FDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQNRDPLQNADAAINYWIQNGA 257 + V +I N +D +N+ A+D+Y P + A +Y P + ++ D+ + W + G Sbjct: 170 YPVLAISNSLDWINLMAYDFYGPGWSTVTGP-PASLYLPTDG---RSGDSGVRDWTEAGL 225 Query: 258 PTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEI 416 P K VLG G W L +D +++G GP G +SY ++ Sbjct: 226 PAKKAVLGFPYYGWAWTL-ADPDVNGY------DANTTGPAISDDGEISYRQL 271 >At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 365 Score = 43.6 bits (98), Expect = 9e-05 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 1/89 (1%) Frame = +3 Query: 72 IYFDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQNRDPLQNADAAINYWIQN 251 + + V +I + +D VNI A+D+Y P +P A + P N ++ ++ + W+ Sbjct: 185 VEYPVKAIADNLDFVNIMAYDFYGPGWSPVTGPPAALFHDPSN-PAGRSGNSGLRKWLDE 243 Query: 252 G-APTHKLVLGISTTGRTWKLDSDSEISG 335 P K VLG G W L+ D+E +G Sbjct: 244 AKLPPKKAVLGFPYCGWAWTLE-DAENNG 271 >At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 363 Score = 43.2 bits (97), Expect = 1e-04 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 1/90 (1%) Frame = +3 Query: 60 VNSSIYFDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQN-RDPLQNADAAIN 236 V S+ + + I +D VN+ A+D+Y+ A ++ P N + P D + Sbjct: 174 VYDSVSYPIREIKKKLDWVNLIAYDFYSSSTT---IGPPAALFDPSNPKGPC--GDYGLK 228 Query: 237 YWIQNGAPTHKLVLGISTTGRTWKLDSDSE 326 WI+ G P K VLG G TW L S ++ Sbjct: 229 EWIKAGLPAKKAVLGFPYVGWTWSLGSGND 258 >At3g16460.2 68416.m02097 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 647 Score = 30.7 bits (66), Expect = 0.70 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +3 Query: 252 GAPTHKL-VLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKL 428 G+ KL G ST G +W D S+ GV I+A GGE Y K + L Sbjct: 249 GSGAQKLEAQGNSTGGTSW--DDGSDYDGVTKIYASYGGEGIQYVKFDYVKGGVTKQGVL 306 Query: 429 INPNQNGKRPHLRKVNDPSK 488 Q+ + P +N P + Sbjct: 307 HGKQQSRQNPREFVINHPDE 326 >At3g16460.1 68416.m02098 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 705 Score = 30.7 bits (66), Expect = 0.70 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +3 Query: 252 GAPTHKL-VLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKL 428 G+ KL G ST G +W D S+ GV I+A GGE Y K + L Sbjct: 249 GSGAQKLEAQGNSTGGTSW--DDGSDYDGVTKIYASYGGEGIQYVKFDYVKGGVTKQGVL 306 Query: 429 INPNQNGKRPHLRKVNDPSK 488 Q+ + P +N P + Sbjct: 307 HGKQQSRQNPREFVINHPDE 326 >At1g30220.1 68414.m03697 sugar transporter family protein similar to SP|Q96QE2 Proton myo-inositol co-transporter (Hmit) [Homo sapiens]; contains Pfam profile PF00083: major facilitator superfamily protein Length = 580 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +1 Query: 205 ILYKTPTLL*ITGFKMVRLPTNLSLVSAPLDVRGSSI 315 ++Y +PT++ + GF R LSLV+A L+ GS I Sbjct: 294 VMYYSPTIVQLAGFASNRTALLLSLVTAGLNAFGSII 330 >At5g42390.1 68418.m05161 metalloendopeptidase identical to chloroplast processing enzyme metalloendopeptidase [Arabidopsis thaliana] gi|2827039|gb|AAC39482 Length = 1265 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -2 Query: 134 VKCLDVDNVDQVYDAWDVKVNGAIYVWQNADN*LHIGFYIECLF 3 +K DVD + + ++ W N +Y+ + DN I IE +F Sbjct: 358 IKKWDVDKIRKFHERWYFPANATLYIVGDIDNIPRIVHNIEAVF 401 >At4g34350.1 68417.m04881 LytB family protein contains Pfam profile: PF02401 LytB protein Length = 466 Score = 28.3 bits (60), Expect = 3.7 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +3 Query: 270 LVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAK 425 LV+G + T L SE G+P D GP K+ L Y E+ K Sbjct: 372 LVVGGWNSSNTSHLQEISEARGIPSYWIDSEKRIGPGNKIAYKLHYGELVEK 423 >At5g57000.1 68418.m07114 expressed protein similar to unknown protein (gb|AAF21159.1) Length = 187 Score = 27.9 bits (59), Expect = 5.0 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 558 LRKKPRSHLHHNHQE 514 L++KP HLHH+H+E Sbjct: 87 LKEKPPRHLHHHHKE 101 >At2g46530.2 68415.m05803 transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related contains Pfam profiles: PF02309 AUX/IAA family, PF02362 B3 DNA binding domain Length = 514 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +1 Query: 409 QKFAPNLLTPTKTESVLIFVRSTILANVLG-PMPSAFL 519 + F+P+ LTPT T+ RS ++ + G P+ S+FL Sbjct: 263 EPFSPSALTPTPTQQQSKSKRSRPISEITGSPVASSFL 300 >At2g46530.1 68415.m05802 transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related contains Pfam profiles: PF02309 AUX/IAA family, PF02362 B3 DNA binding domain Length = 601 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +1 Query: 409 QKFAPNLLTPTKTESVLIFVRSTILANVLG-PMPSAFL 519 + F+P+ LTPT T+ RS ++ + G P+ S+FL Sbjct: 350 EPFSPSALTPTPTQQQSKSKRSRPISEITGSPVASSFL 387 >At1g50790.1 68414.m05712 hypothetical protein Length = 812 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/73 (20%), Positives = 32/73 (43%) Frame = +3 Query: 24 PNMQLVISVLPNVNSSIYFDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQNR 203 P ++++PN + + I + +V I + ++Y P R + ++ P NR Sbjct: 339 PEKATWVTLVPNRDDE-FISFARCIMVSQLVGIDSLEHYYPNRVASQFGRLQDVHCPVNR 397 Query: 204 DPLQNADAAINYW 242 + L A +Y+ Sbjct: 398 NNLSREAAWNDYY 410 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 432 NPNQNGKRPHLRKVNDPSKRFGTYA 506 NPN N +R + K D S FG+YA Sbjct: 44 NPNPNFERSNSSKQCDDSSEFGSYA 68 >At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 501 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -2 Query: 509 EGIGPKTFARIVDLTKMRTLSVLVGVNKFG-ANFW 408 EGIG K R+++L R+ ++++ N+F A W Sbjct: 401 EGIGEKVKKRLIELEPKRSGNLVIVANRFAEARMW 435 >At2g33570.1 68415.m04114 expressed protein Length = 496 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -1 Query: 216 FVEDRGSAVRKSVQCSPPLWGYVQVYNSQMPGC 118 ++ + G+++R Q P WGY +VY + C Sbjct: 147 WISNNGTSIRAKAQKILPDWGYGRVYTVVVVNC 179 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,001,745 Number of Sequences: 28952 Number of extensions: 289371 Number of successful extensions: 874 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1082538160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -