Samia BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0003_C21
         (331 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0001509F85 Cluster: hypothetical protein TTHERM_0044...    30   8.5  

>UniRef50_UPI0001509F85 Cluster: hypothetical protein TTHERM_00445990;
            n=1; Tetrahymena thermophila SB210|Rep: hypothetical
            protein TTHERM_00445990 - Tetrahymena thermophila SB210
          Length = 1516

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = -3

Query: 194  E*LHDKTIQDSEKY*CKWDKFMHLWFRYTAGGAGRQRAFTIYEFALGSCRRDVFYRNI 21
            E ++   I++S+K  CK + F+   F+Y+   +  Q+AF   +     C+R   Y+ I
Sbjct: 1031 EDIYSNCIKNSQKILCKLE-FLRACFQYSLQTSNHQQAFNYIKQINEVCKRSGIYKQI 1087


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 261,412,873
Number of Sequences: 1657284
Number of extensions: 3826886
Number of successful extensions: 6807
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6721
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6807
length of database: 575,637,011
effective HSP length: 86
effective length of database: 433,110,587
effective search space used: 9961543501
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)