BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_C21 (331 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 20 8.9 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 19.8 bits (39), Expect = 8.9 Identities = 13/54 (24%), Positives = 23/54 (42%) Frame = +3 Query: 18 RDVSIEDIASARAERELVYSKSTLPSRPARCIAKP*VHEFVPLTLILFAILYSF 179 + V E+ E+ +S+ + R R I + F P TL++ +SF Sbjct: 168 KPVVAEETVDYMLEKSGNFSRLVVFFRFERQIGHHLIQTFAPSTLVVMLSWFSF 221 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,717 Number of Sequences: 438 Number of extensions: 1369 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7342137 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -