BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_C17 (546 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222299-1|ABN79659.1| 136|Tribolium castaneum ion transport pe... 25 0.57 EF222297-1|ABN79657.1| 140|Tribolium castaneum ion transport pe... 25 0.57 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 2.3 EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport pe... 21 7.0 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 7.0 >EF222299-1|ABN79659.1| 136|Tribolium castaneum ion transport peptide isoform C protein. Length = 136 Score = 24.6 bits (51), Expect = 0.57 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 28 LCTKNCFITKYTK 66 LC KNCF T Y K Sbjct: 84 LCRKNCFTTDYFK 96 >EF222297-1|ABN79657.1| 140|Tribolium castaneum ion transport peptide isoform A protein. Length = 140 Score = 24.6 bits (51), Expect = 0.57 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 28 LCTKNCFITKYTK 66 LC KNCF T Y K Sbjct: 84 LCRKNCFTTDYFK 96 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.6 bits (46), Expect = 2.3 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Frame = -1 Query: 297 LWSKH*AYIV*KKKIKRSQKTNEECM----YLCDXVYAV 193 LW+K + KKK + ++T + CM LCD A+ Sbjct: 211 LWAKKLIVVKDKKKSRSDEQTIDICMRCHDQLCDMCGAI 249 >EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport peptide isoform B protein. Length = 120 Score = 21.0 bits (42), Expect = 7.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 28 LCTKNCFITKY 60 LC CF TKY Sbjct: 84 LCRSECFSTKY 94 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 7.0 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -2 Query: 74 NFTLVYFVIKQF 39 N+TLV+ V+KQ+ Sbjct: 352 NYTLVFSVLKQY 363 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,025 Number of Sequences: 336 Number of extensions: 2728 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -