BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_C09 (371 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 27 0.054 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 23 1.5 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 22 2.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 6.2 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 27.5 bits (58), Expect = 0.054 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 22 FYSEPELIYCM*NEIISKHDCH*NG 96 FYSE + +C+ + S H CH NG Sbjct: 5 FYSEADASHCIQQILESVHHCHHNG 29 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 22.6 bits (46), Expect = 1.5 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +2 Query: 80 TVTKMEVDSTKGEGFRPYYITKIEELQLIVAEKSQNLRRLQA 205 TVT +E +K EG + + K++ + + + +NLR+ A Sbjct: 114 TVTHVESRPSKKEGLQFDVLVKVDMTRQYLLQLIRNLRQSSA 155 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 22.2 bits (45), Expect = 2.0 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = +3 Query: 108 QKVRAFVLTTSRKLKNCNLSWLKSL 182 + ++ + LT + ++KN N+ W K + Sbjct: 91 KNIKLYGLTKNLEIKNYNIDWDKCI 115 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.6 bits (41), Expect = 6.2 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +3 Query: 243 VKNSSFYRNRVHMWVKLSNLWTKRRC 320 +++ S + R HM+ +L++ RRC Sbjct: 1676 IRSHSTWDPRRHMYEELNHCAPNRRC 1701 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,135 Number of Sequences: 438 Number of extensions: 1654 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8928360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -