BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_C08 (448 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24180.1 68417.m03470 pathogenesis-related thaumatin family p... 31 0.47 At5g22540.1 68418.m02630 expressed protein contains Pfam profile... 30 0.62 At3g62160.1 68416.m06984 transferase family protein low similari... 29 1.4 At5g49850.1 68418.m06173 jacalin lectin family protein similar t... 28 3.3 At5g01770.1 68418.m00096 transducin family protein / WD-40 repea... 27 4.4 At4g18250.1 68417.m02710 receptor serine/threonine kinase, putat... 27 5.8 At1g17460.1 68414.m02141 myb family transcription factor contain... 27 5.8 >At4g24180.1 68417.m03470 pathogenesis-related thaumatin family protein similar to SP|P28493 Pathogenesis-related protein 5 precursor (PR-5) {Arabidopsis thaliana}; contains Pfam profile PF00314: Thaumatin family Length = 255 Score = 30.7 bits (66), Expect = 0.47 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -2 Query: 243 GIVTSLNRRVPREFRYGTQAVCKT 172 G VT LN++ P E R+G+ + CK+ Sbjct: 165 GCVTDLNQKCPTELRFGSGSACKS 188 >At5g22540.1 68418.m02630 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 440 Score = 30.3 bits (65), Expect = 0.62 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +1 Query: 274 QRPDNYNLHSVXNYEAIRFLDIFEKTFVQSLQKGKFESYGKKIDFHDEQAINFV 435 Q+P+ + EA LD+ KTFV + + + + K F+D + + FV Sbjct: 204 QKPETF-WEKHYGLEAKHLLDLIRKTFVPVPSQRRIKDHSSKSSFNDHEYLGFV 256 >At3g62160.1 68416.m06984 transferase family protein low similarity to Taxus cuspidata transferases: 10-deacetylbaccatin III-10-O-acetyl transferase GI:6746554, taxadienol acetyl transferase GI:6978038, 2-debenzoyl-7,13-diacetylbaccatin III-2-O-benzoyl transferase GI:11559716; contains Pfam profile PF02458 transferase family Length = 428 Score = 29.1 bits (62), Expect = 1.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -2 Query: 240 IVTSLNRRVPREFRYGTQAVCKTLEVITCC 151 I + L R REFR T +C EVI C Sbjct: 224 IPSDLIERFKREFRASTGEICSAFEVIAAC 253 >At5g49850.1 68418.m06173 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 596 Score = 27.9 bits (59), Expect = 3.3 Identities = 12/59 (20%), Positives = 25/59 (42%) Frame = +1 Query: 106 KHRRGEIYYNFYQQLTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPLMTSYYFPFAQRP 282 K +G F ++ + F + G + WY+P+ GY + ++++P P Sbjct: 386 KTSKGRTSRTFGERTSDSVEFVIESKGCAVVGFHGWYAPLGAGYITALGAHFYPMPLPP 444 >At5g01770.1 68418.m00096 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein mip1 (SP:P87141) [Schizosaccharomyces pombe] Length = 1354 Score = 27.5 bits (58), Expect = 4.4 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = +1 Query: 181 NGLGSIPEFSWYSPIKTGYYPLMTSYYFPFAQRPDNYNLHSVXNYEAIRFLDIFE 345 +GL +IP +W + +TG + + P D V NYE L+ F+ Sbjct: 1004 SGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNGFD 1058 >At4g18250.1 68417.m02710 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 853 Score = 27.1 bits (57), Expect = 5.8 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 382 RICLSVGTVRKSFQKCPRTVLLRSSXRCVDCSCPAFE 272 R C+S G V + + CP+ ++ S V CS E Sbjct: 128 RTCISAGCVVELKKTCPKDLMKMSRENLVACSSTCME 164 >At1g17460.1 68414.m02141 myb family transcription factor contains Pfam PF00249: Myb-like DNA-binding domain Length = 604 Score = 27.1 bits (57), Expect = 5.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 326 GSWTFLKRLSYSPY 367 G WT +K+LS+SPY Sbjct: 517 GKWTEIKKLSFSPY 530 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,144,338 Number of Sequences: 28952 Number of extensions: 174795 Number of successful extensions: 489 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 722638680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -