BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_C05 (409 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 23 1.3 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 23 1.3 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 2.3 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 4.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 20 9.4 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 164 LNISSVPWDHVEARARRCSGGVSAGKRHHRCN 69 ++I+ +D + R CSG +S K CN Sbjct: 43 VHITKDEYDEIGRLKRTCSGDISVTKCEGFCN 74 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 164 LNISSVPWDHVEARARRCSGGVSAGKRHHRCN 69 ++I+ +D + R CSG +S K CN Sbjct: 43 VHITKDEYDEIGRLKRTCSGDISVTKCEGFCN 74 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 22.2 bits (45), Expect = 2.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 220 IPLTWLSAAKHPKTKWP 270 IP+T + KH KTK P Sbjct: 210 IPVTLTTVPKHSKTKSP 226 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 4.1 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 197 SCSDGVRRWYCLNI 156 SCSD + RW L + Sbjct: 434 SCSDKIARWNVLGV 447 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 20.6 bits (41), Expect = 7.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 228 DVVISGKTPEDKMAGILLEARQGDKIVGTWTVS 326 D+ ISGK + +M L+ D+ V TW V+ Sbjct: 99 DLPISGKPFQIRMKHGLIRDLIVDRDVPTWEVN 131 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -2 Query: 312 CRRSCHPDELPGGCR 268 CR+ PDE CR Sbjct: 629 CRQGTVPDETHSACR 643 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,927 Number of Sequences: 438 Number of extensions: 2471 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -