BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_C05 (409 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52550.1 68418.m06525 expressed protein 30 0.52 At2g02120.1 68415.m00148 plant defensin-fusion protein, putative... 29 0.91 At5g10080.1 68418.m01168 aspartyl protease family protein contai... 29 1.6 At5g06580.1 68418.m00743 FAD linked oxidase family protein simil... 27 3.7 At4g04650.1 68417.m00680 hypothetical protein 26 8.5 At3g30240.1 68416.m03821 hypothetical protein 26 8.5 At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family pr... 26 8.5 At2g19920.1 68415.m06036 RNA-dependent RNA polymerase family pro... 26 8.5 >At5g52550.1 68418.m06525 expressed protein Length = 360 Score = 30.3 bits (65), Expect = 0.52 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = -3 Query: 200 DSCSDGVRRWYCLNISSVPWDHVEARARRCSGGVSAGKRHHRCNCYYVSEHH 45 + C D R PWD+ + SGG++ H RC+ Y V +++ Sbjct: 250 EDCDDSYRNTLNQETGFKPWDYT-TKINLFSGGINRFFPHQRCSSYAVHDNN 300 >At2g02120.1 68415.m00148 plant defensin-fusion protein, putative (PDF2.1) plant defensin protein family member, personal communication, Bart Thomma (Bart.Thomma@agr.kuleuven.ac.be); contains a gamma-thionin family signature (PDOC00725) Length = 77 Score = 29.5 bits (63), Expect = 0.91 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = -2 Query: 318 SKCRRSCHPDELPGG-CRPFCLRVFC 244 + C CH + PGG CR F R FC Sbjct: 48 TNCENVCHNEGFPGGDCRGFRRRCFC 73 >At5g10080.1 68418.m01168 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 28.7 bits (61), Expect = 1.6 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +3 Query: 108 GAPPSACF-DMIPGHAADVQTVPAPYTITTAVSSVKAGHSIDVVISGKTP 254 G PS C D I A + +P + T + GH++ I+GKTP Sbjct: 447 GWSPSKCQEDKIEPPQASPGSTSSPNPLPTDEQQSRGGHAVSPAIAGKTP 496 >At5g06580.1 68418.m00743 FAD linked oxidase family protein similar to SP|Q12627 from Kluyveromyces lactis and SP|P32891 from Saccharomyces cerevisiae; contains Pfam FAD linked oxidases, C-terminal domain PF02913, Pfam FAD binding domain PF01565 Length = 567 Score = 27.5 bits (58), Expect = 3.7 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 355 LRGCEKV-SSGLTVQVPTILSP*RASRRMPAILSSGVLPL 239 LR C ++ S+ + T+LSP + RR+P SS + PL Sbjct: 17 LRPCRQLHSTPKSTGDVTVLSPVKGRRRLPTCWSSSLFPL 56 >At4g04650.1 68417.m00680 hypothetical protein Length = 332 Score = 26.2 bits (55), Expect = 8.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -3 Query: 149 VPWDHVEARARRCSGGVSAGKRHHRCNCYYVSEHHLFYKFQ 27 V W+ + R R + G+S CN + S HLF++ Q Sbjct: 149 VAWNRLHTRDRLQNWGLSIPAECLLCNAHDDSRAHLFFECQ 189 >At3g30240.1 68416.m03821 hypothetical protein Length = 189 Score = 26.2 bits (55), Expect = 8.5 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 404 FFGMHLVGHGVIWFTTVEG 348 FF +LVGH + FT+VEG Sbjct: 84 FFAENLVGHALDSFTSVEG 102 >At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family protein / F-box family protein contains similarity to F-box protein FBL2 GI:6010699 from [Rattus norvegicus]; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00646: F-box domain Length = 930 Score = 26.2 bits (55), Expect = 8.5 Identities = 11/47 (23%), Positives = 20/47 (42%) Frame = -3 Query: 197 SCSDGVRRWYCLNISSVPWDHVEARARRCSGGVSAGKRHHRCNCYYV 57 S + + W CL SS W ++ R + ++A N +Y+ Sbjct: 69 SLASTCKTWRCLGASSCLWTSLDLRPHKFDASMAASLASRCVNLHYL 115 >At2g19920.1 68415.m06036 RNA-dependent RNA polymerase family protein contains Pfam domain, PF05183: RNA dependent RNA polymerase Length = 927 Score = 26.2 bits (55), Expect = 8.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 164 DSTSALHHHYSCQLGKSWSFH*RGYQRQNT 253 +S S H+Y C + S+ +GY +NT Sbjct: 207 ESDSGKTHYYQCHVAPDGSYRLKGYFLENT 236 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,213,881 Number of Sequences: 28952 Number of extensions: 220568 Number of successful extensions: 584 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 605614832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -