BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_C04 (444 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein con... 33 0.066 At3g07050.1 68416.m00837 GTP-binding family protein contains Pfa... 29 1.9 At3g10430.1 68416.m01251 F-box family protein contains F-box dom... 28 2.5 At1g25540.1 68414.m03171 phytochrome and flowering time regulato... 28 2.5 At2g27570.1 68415.m03340 sulfotransferase family protein similar... 27 4.3 At5g60970.1 68418.m07648 TCP family transcription factor, putati... 27 5.7 At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein si... 27 5.7 At2g44460.1 68415.m05528 glycosyl hydrolase family 1 protein con... 27 5.7 At5g35750.1 68418.m04281 histidine kinase (AHK2) identical to hi... 26 10.0 At2g44470.1 68415.m05529 glycosyl hydrolase family 1 protein con... 26 10.0 >At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to Cyanogenic Beta-Glucosidase (GI:1311386)(pdb:1CBG) [Trifolium Repens]; identical beta-glucosidase GI:10834547 Length = 577 Score = 33.5 bits (73), Expect = 0.066 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +2 Query: 140 IRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQY 265 + Y ++ NN ++I +NG N + DG +P +++ +RI+Y Sbjct: 394 LNYIKERYNNMPVYIKENGINDNDDGTKPREEIVKDTFRIEY 435 >At3g07050.1 68416.m00837 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 582 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/44 (31%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +3 Query: 306 LIKCSSQTKH-RYQVKGKHQLLALV-EHHDKQLRNARRIAFQHQ 431 ++K S ++K R +K KH++L V EHH K+ ++A+++ + Sbjct: 1 MVKRSKKSKSKRVTLKQKHKVLKKVKEHHKKKAKDAKKLGLHRK 44 >At3g10430.1 68416.m01251 F-box family protein contains F-box domain Pfam:PF00646 Length = 370 Score = 28.3 bits (60), Expect = 2.5 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 444 TGLYSGVEMQFSAHFSIVCRDVPPVLGVDVCP*PG 340 T S + FS +FS+ D+P +D+ P PG Sbjct: 266 TNKLSDEVVSFSRYFSVTLPDIPLFRSIDILPLPG 300 >At1g25540.1 68414.m03171 phytochrome and flowering time regulatory protein (PFT1) PMID: 12815435 Length = 836 Score = 28.3 bits (60), Expect = 2.5 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 324 QTKHRYQVKGKHQLLALVEHHDKQLRNARRIAFQHQNT 437 Q +H+ Q + +HQL L +HH +Q + ++ QHQ T Sbjct: 721 QQQHQQQQQQQHQLSQL-QHHQQQQQQQQQQQQQHQLT 757 >At2g27570.1 68415.m03340 sulfotransferase family protein similar to steroid sulfotransferase from [Brassica napus] GI:3420008, GI:3420006; contains Pfam profile PF00685: Sulfotransferase domain Length = 273 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 234 IHSGRFPS*DLFHPFLSINKFALFS 160 +H + PS D HP LS N LFS Sbjct: 88 VHRSKHPSHDHHHPLLSNNPHVLFS 112 >At5g60970.1 68418.m07648 TCP family transcription factor, putative putative basic helix-loop-helix DNA binding protein TCP2, Arabidopsis thaliana, EMBL:AF072691 Length = 360 Score = 27.1 bits (57), Expect = 5.7 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +2 Query: 182 IDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNYN 286 +DK W K+ + + + ++ Q+PL N YN Sbjct: 192 LDKGKWIKNDENSNQDHQGFNTNHQQQFPLTNPYN 226 >At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein similar to alpha-mannosidase II SP:P27046 from [Mus musculus] Length = 1173 Score = 27.1 bits (57), Expect = 5.7 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 140 IRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPL 271 +RYK ++N + D NG+ S+ + IP+Q Y YP+ Sbjct: 883 VRYKTDVDNKKVFYSDLNGFQMSRRETYDK-IPLQGNY---YPM 922 >At2g44460.1 68415.m05528 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to beta-glucosidase 1 (GI:12043529) [Arabidopsis thaliana] Length = 582 Score = 27.1 bits (57), Expect = 5.7 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +2 Query: 140 IRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDN 277 + Y + NN ++I +NG N DG + + + +RI Y D+ Sbjct: 396 LNYIKDKYNNPIVYIKENGINDYDDGTKSREEILNDTFRISYHEDH 441 >At5g35750.1 68418.m04281 histidine kinase (AHK2) identical to histidine kinase AHK2 [Arabidopsis thaliana] gi|13537196|dbj|BAB40774 Length = 1176 Score = 26.2 bits (55), Expect = 10.0 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 155 QIENNANLFIDKNGWNKSQ 211 ++EN A + IDK+ WNK + Sbjct: 932 KLENLAMILIDKDAWNKEE 950 >At2g44470.1 68415.m05529 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to anther-specific protein ATA27 (GI:2746341) [Arabidopsis thaliana] Length = 451 Score = 26.2 bits (55), Expect = 10.0 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = +2 Query: 140 IRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDN 277 + Y + NN +++ +NG + DG + +++ +RI Y D+ Sbjct: 397 LNYIKDKYNNPIVYVKENGIDHYDDGTKSRETILKDTFRISYHQDH 442 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,986,671 Number of Sequences: 28952 Number of extensions: 203469 Number of successful extensions: 476 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 712739520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -