BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_C03 (391 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2E1P3.05c |||fungal cellulose binding domain protein|Schizos... 28 0.59 SPAC13C5.04 |||glutamine amidotransferase |Schizosaccharomyces p... 27 1.0 SPBC244.01c |sid4||SIN component scaffold protein Sid4 |Schizosa... 26 2.4 SPBC18H10.09 |||zinc finger protein, zf-CHY type|Schizosaccharom... 25 3.1 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 25 4.1 SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase ... 24 7.2 SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subun... 24 7.2 SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr ... 24 7.2 SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pom... 24 9.5 SPAC17G8.13c |mst2||histone acetyltransferase Mst2|Schizosacchar... 24 9.5 >SPAC2E1P3.05c |||fungal cellulose binding domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 197 Score = 27.9 bits (59), Expect = 0.59 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +3 Query: 39 TILAVLLGLVALTYVNGNKVKSYICQG-YYGCEKCCVHLGSGCEKLKSSPFW 191 T+L + L LV+ T + + C G YY CCV +GS C + S+P++ Sbjct: 9 TVLTLALSLVSKTSASQCSPRYGTCGGIYYDGPTCCV-VGSSC--IYSNPWY 57 >SPAC13C5.04 |||glutamine amidotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 248 Score = 27.1 bits (57), Expect = 1.0 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 92 ITVDVSQGYEAQ*NSQDCEFRHF 24 + VDV +G+E +++DCEF+ F Sbjct: 162 MAVDVPEGFELLGSTEDCEFQIF 184 >SPBC244.01c |sid4||SIN component scaffold protein Sid4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 660 Score = 25.8 bits (54), Expect = 2.4 Identities = 18/55 (32%), Positives = 21/55 (38%) Frame = -1 Query: 289 LNTSKFNSLMESPKYGSTPSGQVQVQTSV*LPNQNGEDFNFSQPEPR*TQHFSQP 125 L+ FN + K V V PNQ + NFS QHFSQP Sbjct: 192 LDPEVFNQQSKETKKSLQVPPSRNVPPPVTRPNQYNPEPNFSLSSGYPQQHFSQP 246 >SPBC18H10.09 |||zinc finger protein, zf-CHY type|Schizosaccharomyces pombe|chr 2|||Manual Length = 428 Score = 25.4 bits (53), Expect = 3.1 Identities = 11/43 (25%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +3 Query: 75 TYVNGNKVKSYIC--QGYYGCEKCCVHLGSGCEKLKSSPFWFG 197 T+ + N++ C + +Y + C H G+ K ++S +W G Sbjct: 361 TFEHANRIICGYCAMESFYKKDATCPHCGNMTVKKQTSAYWEG 403 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 25.0 bits (52), Expect = 4.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 119 ILRLREMLCSPWFRLREVKIL 181 +L+L E + PW REVK+L Sbjct: 120 VLKLLENMPMPWEEYREVKVL 140 >SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase Cho2|Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 24.2 bits (50), Expect = 7.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 384 ETNEWFFLFKTSSNSHCFYT 325 E N+W L+K S N+ YT Sbjct: 719 EINDWIGLYKLSDNASDLYT 738 >SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subunit Rpc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1165 Score = 24.2 bits (50), Expect = 7.2 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 15 TRNEMSKFTILAVLLGLVALTYVNGNKVKSYIC 113 T E+ FTIL + GL+ + N + +Y C Sbjct: 684 THLEIEPFTILGAVAGLIPYPHHNQSPRNTYQC 716 >SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 962 Score = 24.2 bits (50), Expect = 7.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 362 YLKQARTLIVFILLITLKTID 300 YL + RTL+ F L+ KTID Sbjct: 872 YLNRERTLLNFYLIENSKTID 892 >SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pombe|chr 2|||Manual Length = 1692 Score = 23.8 bits (49), Expect = 9.5 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +3 Query: 21 NEMSKFTILAVLLGLVALTYVNGNKVKSY 107 NE++ +I + L+ Y NGN++ S+ Sbjct: 864 NELANLSISSTAQVLLETLYANGNRLSSF 892 >SPAC17G8.13c |mst2||histone acetyltransferase Mst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 407 Score = 23.8 bits (49), Expect = 9.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 91 LPLT*VKATRPSKTARIVNFD 29 +P T +K+T SKT I+ FD Sbjct: 1 MPATILKSTASSKTLLIIKFD 21 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,603,780 Number of Sequences: 5004 Number of extensions: 31266 Number of successful extensions: 81 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 128029482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -