BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_C03 (391 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0773 + 6002563-6003069,6003183-6003299,6003447-6003539 28 3.0 07_03_0909 + 22512313-22512474,22513151-22513465,22513539-225166... 27 4.0 11_01_0308 + 2307623-2307697,2308554-2308790,2310109-2310282 27 5.3 02_03_0415 + 18805541-18805610,18805962-18806128,18806616-188066... 27 7.0 09_02_0338 + 7426999-7428322,7428390-7428646 26 9.2 04_04_1268 - 32262994-32263017,32263411-32263488,32263653-322638... 26 9.2 03_02_0752 - 10922456-10922644,10922719-10922796,10922888-109230... 26 9.2 >01_01_0773 + 6002563-6003069,6003183-6003299,6003447-6003539 Length = 238 Score = 27.9 bits (59), Expect = 3.0 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 Query: 240 RLRLDRYRCRPQCNFRTRTARILTSRSRNQGEHSISRN 127 R R+ R R P+C +R TAR + ++ EH N Sbjct: 27 RRRVARVRLAPRCQWRPLTARAQAAATQPDPEHQAPAN 64 >07_03_0909 + 22512313-22512474,22513151-22513465,22513539-22516633, 22516812-22516910,22517031-22517379 Length = 1339 Score = 27.5 bits (58), Expect = 4.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 387 IETNEWFFLFKTSSNSHCFYT 325 I TN+W LF+TS + HC T Sbjct: 143 IMTNDWEVLFETSLDPHCDLT 163 >11_01_0308 + 2307623-2307697,2308554-2308790,2310109-2310282 Length = 161 Score = 27.1 bits (57), Expect = 5.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 95 SEVLHMPRILRLREMLCSPWFRL 163 S +LH R+ R+R+ML P +RL Sbjct: 117 SMILHQDRLRRVRQMLTRPRYRL 139 >02_03_0415 + 18805541-18805610,18805962-18806128,18806616-18806645, 18807459-18807515,18808268-18808337,18808915-18810998 Length = 825 Score = 26.6 bits (56), Expect = 7.0 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 213 RPQCNFRTRTARILTSRSRNQGEH 142 RP+ NF + + L S+SR+ G+H Sbjct: 446 RPKANFAPTSMKDLPSKSRSSGDH 469 >09_02_0338 + 7426999-7428322,7428390-7428646 Length = 526 Score = 26.2 bits (55), Expect = 9.2 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 18 RNEMSKFTILAVLLGLVALTYVNGNKVKSYICQ 116 RN M +LA LGLV L +KSY C+ Sbjct: 411 RNPMLVVALLAATLGLVCLLLQAIYTMKSYYCE 443 >04_04_1268 - 32262994-32263017,32263411-32263488,32263653-32263800, 32263890-32264127,32264210-32264420,32264499-32264680, 32264765-32264866,32265009-32266317,32266906-32266988, 32267436-32267559 Length = 832 Score = 26.2 bits (55), Expect = 9.2 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 183 PFWFGSYTEVCT-CTCPDGVDPYLGDSIS 266 PF + +T V C CPDG +P +S S Sbjct: 378 PFGYCDFTSVIPRCQCPDGFEPNGSNSSS 406 >03_02_0752 - 10922456-10922644,10922719-10922796,10922888-10923016, 10923105-10923152,10923243-10923333,10923517-10923648, 10923869-10924086,10925121-10925271,10925360-10926009, 10926715-10926786,10926938-10926985,10927105-10927242, 10927750-10927756,10928064-10928212 Length = 699 Score = 26.2 bits (55), Expect = 9.2 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 111 CQGYYGCEKCCVHLGSGCEKLKS 179 C+ Y GC K C + GC KS Sbjct: 473 CEKYCGCSKSCKNRFRGCHCAKS 495 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,821,961 Number of Sequences: 37544 Number of extensions: 193479 Number of successful extensions: 535 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 535 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 660830060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -