Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0003_C03
         (391 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.       23   3.9  
AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote...    22   6.9  
AJ438610-11|CAD27483.1|  765|Anopheles gambiae hypothetical prot...    22   6.9  
DQ974165-1|ABJ52805.1|  482|Anopheles gambiae serpin 5 protein.        22   9.1  
AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.           22   9.1  
AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.           22   9.1  
AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.           22   9.1  
AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.           22   9.1  
AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.           22   9.1  
AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.           22   9.1  
AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.           22   9.1  
AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein prot...    22   9.1  

>AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.
          Length = 1009

 Score = 23.0 bits (47), Expect = 3.9
 Identities = 11/60 (18%), Positives = 23/60 (38%)
 Frame = +3

Query: 78  YVNGNKVKSYICQGYYGCEKCCVHLGSGCEKLKSSPFWFGSYTEVCTCTCPDGVDPYLGD 257
           Y NG      + + ++        +   C +  ++  +  S    C  TCP+G +  L +
Sbjct: 122 YANGEVTTRSVGEKWFNMVNETTCMNYECLRNDANETFINSIGIQCNTTCPEGFEAQLSE 181


>AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein
           protein.
          Length = 1645

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 129 CEKCCVHLG 155
           CEKC  HLG
Sbjct: 8   CEKCLAHLG 16


>AJ438610-11|CAD27483.1|  765|Anopheles gambiae hypothetical protein
           protein.
          Length = 765

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 129 CEKCCVHLG 155
           CEKC  HLG
Sbjct: 8   CEKCLAHLG 16


>DQ974165-1|ABJ52805.1|  482|Anopheles gambiae serpin 5 protein.
          Length = 482

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = -2

Query: 243 GRLRLDRYRCRPQCNFRTRTARILTSRSRNQGEHSI 136
           G LRL++YR     N     AR+L   +R+ G   I
Sbjct: 106 GVLRLEQYRKPGSGNIPKNYARLLKEFTRDIGGKGI 141


>AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 111 CQGYYGCEKCCV 146
           C  YYGC + CV
Sbjct: 306 CSRYYGCLEGCV 317


>AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 111 CQGYYGCEKCCV 146
           C  YYGC + CV
Sbjct: 306 CSRYYGCLEGCV 317


>AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 111 CQGYYGCEKCCV 146
           C  YYGC + CV
Sbjct: 306 CSRYYGCLEGCV 317


>AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 111 CQGYYGCEKCCV 146
           C  YYGC + CV
Sbjct: 305 CSRYYGCLEGCV 316


>AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 111 CQGYYGCEKCCV 146
           C  YYGC + CV
Sbjct: 305 CSRYYGCLEGCV 316


>AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 111 CQGYYGCEKCCV 146
           C  YYGC + CV
Sbjct: 306 CSRYYGCLEGCV 317


>AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 111 CQGYYGCEKCCV 146
           C  YYGC + CV
Sbjct: 306 CSRYYGCLEGCV 317


>AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein
           protein.
          Length = 373

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 111 CQGYYGCEKCCV 146
           C  YYGC + CV
Sbjct: 306 CSRYYGCLEGCV 317


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 402,302
Number of Sequences: 2352
Number of extensions: 7766
Number of successful extensions: 23
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 23
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 30356973
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)