BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B23 (553 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe... 28 1.1 SPBC1861.09 |ppk22||serine/threonine protein kinase Ppk22 |Schiz... 27 2.4 SPBC30D10.10c |tor1||phosphatidylinositol kinase Tor1|Schizosacc... 26 3.2 SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharom... 25 7.4 >SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 27.9 bits (59), Expect = 1.1 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -1 Query: 250 VPGADTDHFANGGRFQIGHE-EVVYHR 173 +PG T HF NG +F+I E E +Y++ Sbjct: 374 IPGMSTSHFENGLQFEIDDEMEPLYNQ 400 >SPBC1861.09 |ppk22||serine/threonine protein kinase Ppk22 |Schizosaccharomyces pombe|chr 2|||Manual Length = 526 Score = 26.6 bits (56), Expect = 2.4 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = +2 Query: 89 EFYKVLQGLCKQTGEFKDECLHLAE----QYYPVIYNFLVADLKPAAI 220 EF++ L L K KD C + AE Y + F+ DLKP I Sbjct: 239 EFFRALHSLPKHILPEKDACFYAAEVTAALEYLHLMGFIYRDLKPENI 286 >SPBC30D10.10c |tor1||phosphatidylinositol kinase Tor1|Schizosaccharomyces pombe|chr 2|||Manual Length = 2335 Score = 26.2 bits (55), Expect = 3.2 Identities = 10/25 (40%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +3 Query: 75 TQLSLSSTR-CCKVFASKPVNSKTN 146 +++ +++ R CC+VFA P+ KTN Sbjct: 493 SEIRIAAARTCCQVFARDPICRKTN 517 >SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 25.0 bits (52), Expect = 7.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 62 VLIANTTELEFYKVLQGLCKQTGE 133 VL+A TTE F K + L +TG+ Sbjct: 828 VLLAPTTETSFLKEISNLLDRTGD 851 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,104,085 Number of Sequences: 5004 Number of extensions: 40679 Number of successful extensions: 121 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 229961028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -