BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B22 (270 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0002 - 11387119-11387780,11388756-11388954,11389033-113891... 27 2.1 04_04_1171 - 31455136-31455482,31455805-31458982 27 2.1 12_02_0921 - 24352178-24352324,24352840-24352890,24354188-243542... 26 3.6 >09_03_0002 - 11387119-11387780,11388756-11388954,11389033-11389106, 11389840-11390323,11390439-11390450 Length = 476 Score = 27.1 bits (57), Expect = 2.1 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 224 SRRRDVDNNLCVSVIHYVVLRHRYYDWSTHVD 129 SR +D+D N+ +S H + + DW VD Sbjct: 84 SRPQDIDGNIEISKPHVAISESKEEDWLEDVD 115 >04_04_1171 - 31455136-31455482,31455805-31458982 Length = 1174 Score = 27.1 bits (57), Expect = 2.1 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -2 Query: 233 SRWSRRRDVDNNLCVSVIHYVVLRHRYYDWS-THVDL 126 SRW+ R + +CVSV H +V H YD+ H D+ Sbjct: 971 SRWTVRERL--RVCVSVAHGLVYLHSGYDFPVVHCDV 1005 >12_02_0921 - 24352178-24352324,24352840-24352890,24354188-24354253, 24354771-24354875 Length = 122 Score = 26.2 bits (55), Expect = 3.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 82 CYIELSMIV*LKCFYSIFLHACTT 11 C I+L I L+ +YSIF+H+ +T Sbjct: 46 CVIKLYKIGRLQVYYSIFIHSSST 69 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,031,250 Number of Sequences: 37544 Number of extensions: 87676 Number of successful extensions: 141 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 14,793,348 effective HSP length: 68 effective length of database: 12,240,356 effective search space used: 257047476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -