BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B22 (270 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 0.51 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 0.51 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 3.6 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 20 4.7 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 20 4.7 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 20 4.7 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 20 4.7 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 20 4.7 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 20 4.7 AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 20 4.7 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 20 6.2 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 20 6.2 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 20 6.2 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 20 6.2 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 20 6.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 20 6.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 20 6.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 20 6.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 20 6.2 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 0.51 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 169 FFGTVIMIGALMLTYNYTTLNHNI--TALLPCYI 74 FF + +GAL+ +Y N+N+ AL+ C + Sbjct: 288 FFSYALGLGALVALGSYNKFNNNVYKDALIVCTV 321 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 0.51 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 169 FFGTVIMIGALMLTYNYTTLNHNI--TALLPCYI 74 FF + +GAL+ +Y N+N+ AL+ C + Sbjct: 341 FFSYALGLGALVALGSYNKFNNNVYKDALIVCTV 374 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.6 bits (41), Expect = 3.6 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITALLPCYIELSMI 59 +I +L YNY N+N L I + I Sbjct: 314 IISSLSNNYNYNNYNNNYKPLYYNIINIEQI 344 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 4.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITALLPCY 77 +I +L YNY+ N+N L CY Sbjct: 81 IISSLSNNYNYSNYNNNNYKQL-CY 104 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 4.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITALLPCY 77 +I +L YNY+ N+N L CY Sbjct: 81 IISSLSNNYNYSNYNNNNYKQL-CY 104 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 4.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITALLPCY 77 +I +L YNY+ N+N L CY Sbjct: 81 IISSLSNNYNYSNYNNNNYKQL-CY 104 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 4.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITALLPCY 77 +I +L YNY+ N+N L CY Sbjct: 81 IISSLSNNYNYSNYNNNNYKQL-CY 104 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 4.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITALLPCY 77 +I +L YNY+ N+N L CY Sbjct: 81 IISSLSNNYNYSNYNNNNYKQL-CY 104 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 4.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITALLPCY 77 +I +L YNY+ N+N L CY Sbjct: 81 IISSLSNNYNYSNYNNNNYKQL-CY 104 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 20.2 bits (40), Expect = 4.7 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = -3 Query: 169 FFGTVIMIGALMLTYNYTTLNHNITALLPCYIELSMIV*LKCFYSIFL 26 + TV+ G M + ITAL P +++ +I + YS+++ Sbjct: 69 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWI 116 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 19.8 bits (39), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITAL 89 +I +L YNY N+N L Sbjct: 81 IISSLSNNYNYNNYNNNYKPL 101 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 19.8 bits (39), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITAL 89 +I +L YNY N+N L Sbjct: 81 IISSLSNNYNYNNYNNNYKPL 101 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 19.8 bits (39), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITAL 89 +I +L YNY N+N L Sbjct: 81 IISSLSNNYNYNNYNNNYKPL 101 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 19.8 bits (39), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITAL 89 +I +L YNY N+N L Sbjct: 81 IISSLSNNYNYNNYNNNYKPL 101 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 19.8 bits (39), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITAL 89 +I +L YNY N+N L Sbjct: 314 IISSLSNNYNYNNYNNNYKPL 334 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 19.8 bits (39), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITAL 89 +I +L YNY N+N L Sbjct: 314 IISSLSNNYNYNNYNNNYKPL 334 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 19.8 bits (39), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITAL 89 +I +L YNY N+N L Sbjct: 314 IISSLSNNYNYNNYNNNYKPL 334 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 19.8 bits (39), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITAL 89 +I +L YNY N+N L Sbjct: 314 IISSLSNNYNYNNYNNNYKPL 334 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 19.8 bits (39), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 151 MIGALMLTYNYTTLNHNITAL 89 +I +L YNY N+N L Sbjct: 303 IISSLSNNYNYNNYNNNYKPL 323 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,736 Number of Sequences: 438 Number of extensions: 1472 Number of successful extensions: 20 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 48 effective length of database: 125,319 effective search space used: 5138079 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.9 bits)
- SilkBase 1999-2023 -