BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B21 (355 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) 28 1.9 SB_21821| Best HMM Match : MRG (HMM E-Value=0) 28 2.5 SB_52713| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-26) 27 4.4 SB_40027| Best HMM Match : RVT_1 (HMM E-Value=3.8e-11) 27 5.8 SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 SB_58936| Best HMM Match : GBP (HMM E-Value=2.2e-05) 26 7.7 SB_17889| Best HMM Match : Patched (HMM E-Value=0.14) 26 7.7 >SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 40 ALLILGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRP 174 A +I GF+ + C +RY Q+ N +N W+ S NRP Sbjct: 6 ATIIRGFLKFRIICEKVRYFTQLRACYN--PQQNKWDTSHTNNRP 48 >SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) Length = 997 Score = 28.3 bits (60), Expect = 1.9 Identities = 24/68 (35%), Positives = 31/68 (45%) Frame = +1 Query: 52 LGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNY 231 LG I SQA NIR Q N +L + N + P+Q GY+ PL +NY Sbjct: 612 LGQITSQAIGSNIR---QDVANVSLPLQMPISNPKTSVPQGGATPMQFGYQGYGPLQHNY 668 Query: 232 NFIAFIFP 255 + IFP Sbjct: 669 GDMNTIFP 676 >SB_21821| Best HMM Match : MRG (HMM E-Value=0) Length = 292 Score = 27.9 bits (59), Expect = 2.5 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 55 GFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIP 186 G + +A C+ + K E A I NGWNK+ D EW+P Sbjct: 18 GPLIYEAKCIRGQLK---EKTARYLIHYNGWNKNWD----EWVP 54 >SB_52713| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-26) Length = 333 Score = 27.1 bits (57), Expect = 4.4 Identities = 13/50 (26%), Positives = 29/50 (58%) Frame = -3 Query: 152 LFHPFLSINKFALFSICLLYLIFMQVA*LAIKPSIRSAHSLSISNYNNKN 3 +F P + I F + ICL+ L++ ++ +A + S +++ + + YN+ N Sbjct: 167 IFDP-IQILVFVILPICLMLLVYARIFVIARRISKQTSQTQNQLRYNDNN 215 >SB_40027| Best HMM Match : RVT_1 (HMM E-Value=3.8e-11) Length = 587 Score = 26.6 bits (56), Expect = 5.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 189 NWDPFGTVPVLRFVPSVLVNK*IRVVFYLPFVS 91 +W P VP+ + P V VNK +R + P +S Sbjct: 276 SWKPADVVPLPKLKPVVDVNKHLRPISLTPAIS 308 >SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2077 Score = 26.6 bits (56), Expect = 5.8 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +1 Query: 163 GNRPEWIPIQNGYRIQYPLDNNYNFIAFIFPN 258 G+R ++ IQNG + ++ + + ++FPN Sbjct: 1122 GSRDSFVAIQNGRQWMLDIEESISIAFYVFPN 1153 >SB_58936| Best HMM Match : GBP (HMM E-Value=2.2e-05) Length = 480 Score = 26.2 bits (55), Expect = 7.7 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -2 Query: 261 LIRKNEGYKIIIVVQRVLNSVTILNWDPFGTVPVLRF 151 L+ KN+ + VV R+L ++T + D F + P+L + Sbjct: 7 LVSKNKQEGALGVVSRILTNLTSVGADIFKSAPLLNY 43 >SB_17889| Best HMM Match : Patched (HMM E-Value=0.14) Length = 925 Score = 26.2 bits (55), Expect = 7.7 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = -3 Query: 152 LFHPFLSINKFALFSICLLYLIFMQVA*LAIKPSIRSAHSLSISNYN 12 +F P L ++ F +FS L+++ + V + P++ + L N+N Sbjct: 381 VFSPLLGVSTFGIFSALLVFVNYCSV--ITFFPTVVITYELYWKNWN 425 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,655,330 Number of Sequences: 59808 Number of extensions: 233042 Number of successful extensions: 513 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 548040812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -