BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B16 (624 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 25 2.6 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 25 2.6 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 23 6.0 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 7.9 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 7.9 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 24.6 bits (51), Expect = 2.6 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -2 Query: 512 LDSDAHFKRHRLL*VTPSLPQTGSFSRVHIHGCKLASLAPWH 387 L SDA K +L P L S+ R H H K A + P H Sbjct: 510 LISDAKVKGRPIL---PLLKTVQSYKREHYHDFKEADVLPQH 548 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 24.6 bits (51), Expect = 2.6 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 136 IYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIV 234 I+S VCG +T C +Y HS T V Sbjct: 342 IHSDVCGPMEETTLGGCRYYMTLIDDHSRYTFV 374 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 23.4 bits (48), Expect = 6.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 304 NGKTYANKCSLECTQKIIPSL 366 NG NKC +C ++ PS+ Sbjct: 110 NGDVTVNKCEGKCNSQVQPSV 130 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +1 Query: 286 APVC-GSNGKTYANKCSLEC 342 A VC G+NG T A+ LEC Sbjct: 159 ATVCRGANGATAASDACLEC 178 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +1 Query: 286 APVC-GSNGKTYANKCSLEC 342 A VC G+NG T A+ LEC Sbjct: 159 ATVCRGANGATAASDACLEC 178 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 739,941 Number of Sequences: 2352 Number of extensions: 17340 Number of successful extensions: 29 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -