BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B15 (507 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6DGH3 Cluster: Zgc:92922; n=13; Euteleostomi|Rep: Zgc:... 72 9e-12 UniRef50_P60468 Cluster: Protein transport protein Sec61 subunit... 70 3e-11 UniRef50_Q5BSB6 Cluster: SJCHGC05179 protein; n=3; Bilateria|Rep... 46 5e-04 UniRef50_P38389 Cluster: Protein transport protein Sec61 subunit... 35 0.92 UniRef50_Q0JLV5 Cluster: Os01g0565900 protein; n=3; Magnoliophyt... 35 1.2 UniRef50_A4RRJ9 Cluster: Predicted protein; n=1; Ostreococcus lu... 35 1.2 UniRef50_A3YH88 Cluster: Putative uncharacterized protein; n=1; ... 33 3.7 UniRef50_Q245M1 Cluster: Putative uncharacterized protein; n=1; ... 32 6.5 >UniRef50_Q6DGH3 Cluster: Zgc:92922; n=13; Euteleostomi|Rep: Zgc:92922 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 97 Score = 71.7 bits (168), Expect = 9e-12 Identities = 37/77 (48%), Positives = 40/77 (51%) Frame = +3 Query: 120 TSAPRTASGXXXXXXXXXXXXXXXXXXXXXXGSGGMWRFYTDDSXXXXXXXXXXXXMSLL 299 T APRTA G+GGMWRFYT+DS MSLL Sbjct: 21 TVAPRTAGTSARQRKATSSSARSGGRSTASAGTGGMWRFYTEDSPGLKVGPVPVLVMSLL 80 Query: 300 FIASVFMLHIWGKYTRA 350 FIASVFMLHIWGKYTR+ Sbjct: 81 FIASVFMLHIWGKYTRS 97 >UniRef50_P60468 Cluster: Protein transport protein Sec61 subunit beta; n=31; Eukaryota|Rep: Protein transport protein Sec61 subunit beta - Homo sapiens (Human) Length = 96 Score = 70.1 bits (164), Expect = 3e-11 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +3 Query: 213 GSGGMWRFYTDDSXXXXXXXXXXXXMSLLFIASVFMLHIWGKYTRA 350 G+GGMWRFYT+DS MSLLFIASVFMLHIWGKYTR+ Sbjct: 51 GTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 96 >UniRef50_Q5BSB6 Cluster: SJCHGC05179 protein; n=3; Bilateria|Rep: SJCHGC05179 protein - Schistosoma japonicum (Blood fluke) Length = 88 Score = 46.0 bits (104), Expect = 5e-04 Identities = 20/39 (51%), Positives = 24/39 (61%) Frame = +3 Query: 234 FYTDDSXXXXXXXXXXXXMSLLFIASVFMLHIWGKYTRA 350 FY++DS MSL FI SVF+LH WGKYTR+ Sbjct: 49 FYSEDSPGIKVGPVPVLVMSLCFIVSVFLLHFWGKYTRS 87 >UniRef50_P38389 Cluster: Protein transport protein Sec61 subunit beta; n=13; Magnoliophyta|Rep: Protein transport protein Sec61 subunit beta - Arabidopsis thaliana (Mouse-ear cress) Length = 82 Score = 35.1 bits (77), Expect = 0.92 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +3 Query: 216 SGGMWRFYTDDSXXXXXXXXXXXXMSLLFIASVFMLHIWGK 338 +G M +FYTDD+ MS+ FIA V +LH+ GK Sbjct: 37 AGSMLQFYTDDAPGLKISPNVVLIMSIGFIAFVAVLHVMGK 77 >UniRef50_Q0JLV5 Cluster: Os01g0565900 protein; n=3; Magnoliophyta|Rep: Os01g0565900 protein - Oryza sativa subsp. japonica (Rice) Length = 80 Score = 34.7 bits (76), Expect = 1.2 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 213 GSGGMWRFYTDDSXXXXXXXXXXXXMSLLFIASVFMLHIWGKYTR 347 G+ M +FYTD++ MS+ FIA V +LH++GK R Sbjct: 33 GASTMLQFYTDEAAGRKMSPNSVLIMSIGFIAVVALLHVFGKLYR 77 >UniRef50_A4RRJ9 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 76 Score = 34.7 bits (76), Expect = 1.2 Identities = 18/42 (42%), Positives = 21/42 (50%) Frame = +3 Query: 213 GSGGMWRFYTDDSXXXXXXXXXXXXMSLLFIASVFMLHIWGK 338 GSG + RFYTD+S MS+ FI V MLH K Sbjct: 25 GSGSLLRFYTDESPGLKITPVVVLGMSVCFIGFVTMLHAIAK 66 >UniRef50_A3YH88 Cluster: Putative uncharacterized protein; n=1; Marinomonas sp. MED121|Rep: Putative uncharacterized protein - Marinomonas sp. MED121 Length = 329 Score = 33.1 bits (72), Expect = 3.7 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -1 Query: 489 ESLTYLFHYMIKNTKLYKHHNYTLSNAPPYFSLFHNHPKKNS 364 E L+Y +H IK+++L H+Y + P+F +F P NS Sbjct: 277 EQLSYAWHVAIKHSRL---HHYKWDKSRPHFEIFQAGPHNNS 315 >UniRef50_Q245M1 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1575 Score = 32.3 bits (70), Expect = 6.5 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +3 Query: 357 RNNCFFLDDCEIMKSMVEHLRVCSYGVYII 446 R N F DD E MK+ E L C++ VYII Sbjct: 1074 RRNNIFADDLEEMKNSYEQLMNCNFHVYII 1103 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 435,553,546 Number of Sequences: 1657284 Number of extensions: 7471126 Number of successful extensions: 17443 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 17016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17440 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 30528237263 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -