BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B15 (507 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025715-6|AAK68450.1| 81|Caenorhabditis elegans Hypothetical ... 62 3e-10 Z46793-2|CAA86771.1| 322|Caenorhabditis elegans Hypothetical pr... 27 5.9 U29488-12|AAA68769.3| 617|Caenorhabditis elegans Hypothetical p... 27 7.8 >AC025715-6|AAK68450.1| 81|Caenorhabditis elegans Hypothetical protein Y38F2AR.9 protein. Length = 81 Score = 61.7 bits (143), Expect = 3e-10 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 216 SGGMWRFYTDDSXXXXXXXXXXXXMSLLFIASVFMLHIWGKYTRA 350 +GG+WRFYT+DS MSL+FIASVF+LHIWGK+TR+ Sbjct: 35 NGGLWRFYTEDSTGLKIGPVPVLVMSLVFIASVFVLHIWGKFTRS 79 >Z46793-2|CAA86771.1| 322|Caenorhabditis elegans Hypothetical protein C56G7.3 protein. Length = 322 Score = 27.5 bits (58), Expect = 5.9 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 462 MIKNTKLYKHHNYTLSNAPPYFSLFHNHPKKNSCSLIMLL 343 M + +YK TL+N FS +K+ SLIMLL Sbjct: 271 MCRFCSIYKSQKCTLANTQTIFSEITRQLEKSPLSLIMLL 310 >U29488-12|AAA68769.3| 617|Caenorhabditis elegans Hypothetical protein C56C10.1 protein. Length = 617 Score = 27.1 bits (57), Expect = 7.8 Identities = 9/23 (39%), Positives = 18/23 (78%) Frame = +1 Query: 85 LWDLEVDRRVRLLQPHVQLAEAL 153 +W++E+D+RV L+P+V+ A + Sbjct: 76 VWNIEIDQRVFFLRPNVENARKI 98 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,544,957 Number of Sequences: 27780 Number of extensions: 198220 Number of successful extensions: 442 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -