BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B08 (502 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 24 2.5 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 2.5 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 24.2 bits (50), Expect = 2.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 214 VLSKSACVGIVLAYSTIKVSPFGVNGAEYTT 306 VL +A I A +T+K P GVN Y T Sbjct: 135 VLIVAAGCSICAAQTTVKRYPTGVNATRYGT 165 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.2 bits (50), Expect = 2.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 359 GDKEHAFLAIKEIDDNYYVVYSA 291 GD H F ++ DNYYV + A Sbjct: 172 GDAAHQFEHMQITADNYYVTWEA 194 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 475,559 Number of Sequences: 2352 Number of extensions: 8801 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -