BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B05 (481 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 26 0.18 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.56 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 3.9 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 6.9 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.1 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 9.1 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 26.2 bits (55), Expect = 0.18 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 Query: 276 IAKEESFGPIMIISKFSSRNMEDVIRRANNTEYGL 380 + KEE+ +IS FS +++E +IRR N+ Y L Sbjct: 93 LCKEEALWNFPMISVFSRQDIETIIRR--NSRYPL 125 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 24.6 bits (51), Expect = 0.56 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 300 PIMIISKFSSRNMEDVIRRANNTEYGLASGV-FTRDVSRALQF 425 P+MII++F D RAN+ ++ + V R ++ +Q+ Sbjct: 708 PVMIITEFMENGSLDTFLRANDGKFQVLQLVGMLRGIASGMQY 750 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 3.9 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 27 ETIHDEFV-KRVLEETKKMSIGDPLHRGTAHGPQNHKAHMDKL 152 ET + F +R E +K+ I L T H N+K + KL Sbjct: 294 ETSKERFRDRRERERSKESKIISSLSNKTIHNNNNYKNYNKKL 336 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.0 bits (42), Expect = 6.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -3 Query: 338 HVPAAKFADNHDRSERFLLSDV 273 H+P A D+ + R+L DV Sbjct: 426 HIPHASVTDSENTVPRYLSPDV 447 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 20.6 bits (41), Expect = 9.1 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 Query: 388 ACSRGTCRARCSSRN 432 AC +G C SS N Sbjct: 121 ACKQGVCTVEVSSEN 135 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 20.6 bits (41), Expect = 9.1 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 Query: 388 ACSRGTCRARCSSRN 432 AC +G C SS N Sbjct: 121 ACKQGVCTVEVSSEN 135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,478 Number of Sequences: 438 Number of extensions: 2057 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13051674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -