BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B04 (353 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g22970.1 68417.m03315 peptidase C50 family protein contains P... 30 0.51 At3g07050.1 68416.m00837 GTP-binding family protein contains Pfa... 29 1.2 At3g10430.1 68416.m01251 F-box family protein contains F-box dom... 28 1.6 At1g25540.1 68414.m03171 phytochrome and flowering time regulato... 27 2.7 At5g23910.1 68418.m02808 kinesin motor protein-related 26 6.3 At5g39080.1 68418.m04728 transferase family protein similar to a... 26 8.3 >At4g22970.1 68417.m03315 peptidase C50 family protein contains Pfam PF03568: Peptidase family C50 Length = 1773 Score = 29.9 bits (64), Expect = 0.51 Identities = 23/76 (30%), Positives = 35/76 (46%) Frame = +3 Query: 42 VTEFNTLWTTIIIL*PSFFLIKCSSQTKHRCQVKGKHQLLALVEHHDKQLRNARRIAFQH 221 V++F + +I + L CSS + + K Q L L E K+L+NA+ I + Sbjct: 911 VSQFGVKFAGFLIPFVNKLLDLCSSSLISQGNLYHKKQCLDLAE---KELQNAKEILIAN 967 Query: 222 QNTTPCVVAIIKLTKT 269 Q CV +KL T Sbjct: 968 QRDFSCVKCKLKLEVT 983 >At3g07050.1 68416.m00837 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 582 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/44 (31%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +3 Query: 99 LIKCSSQTKH-RCQVKGKHQLLALV-EHHDKQLRNARRIAFQHQ 224 ++K S ++K R +K KH++L V EHH K+ ++A+++ + Sbjct: 1 MVKRSKKSKSKRVTLKQKHKVLKKVKEHHKKKAKDAKKLGLHRK 44 >At3g10430.1 68416.m01251 F-box family protein contains F-box domain Pfam:PF00646 Length = 370 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -3 Query: 237 TGLYSGVEMQFSAHFSIVCRDVPPVLGVDVCP*PG 133 T S + FS +FS+ D+P +D+ P PG Sbjct: 266 TNKLSDEVVSFSRYFSVTLPDIPLFRSIDILPLPG 300 >At1g25540.1 68414.m03171 phytochrome and flowering time regulatory protein (PFT1) PMID: 12815435 Length = 836 Score = 27.5 bits (58), Expect = 2.7 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 117 QTKHRCQVKGKHQLLALVEHHDKQLRNARRIAFQHQNT 230 Q +H+ Q + +HQL L +HH +Q + ++ QHQ T Sbjct: 721 QQQHQQQQQQQHQLSQL-QHHQQQQQQQQQQQQQHQLT 757 >At5g23910.1 68418.m02808 kinesin motor protein-related Length = 665 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 293 FGHKIVFPGFCKFYYRYHTRGCILVL 216 FG + +F GF KFY + T IL+L Sbjct: 398 FGRRGIFSGFFKFYGSHGTAYLILLL 423 >At5g39080.1 68418.m04728 transferase family protein similar to anthocyanin 5-aromatic acyltransferase from Gentiana triflora GI:4185599, malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase from Perilla frutescens GI:17980232, Salvia splendens GI:17980234; contains Pfam profile PF02458 transferase family Length = 463 Score = 25.8 bits (54), Expect = 8.3 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -2 Query: 172 STSARS*CLPLTWQRCLVWELHLIRKNEGYKIIIVVQRVLNSVTILN 32 S SA S LPLT+ + ++L + + Y+I V + +SV + N Sbjct: 18 SDSAESLSLPLTYFDLIYYKLRAVERVIFYRITNVTRPFFDSVIVPN 64 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,993,138 Number of Sequences: 28952 Number of extensions: 183630 Number of successful extensions: 348 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 348 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 449370720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -