BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B03 (564 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 3.7 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 4.9 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 6.5 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 8.6 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 8.6 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 8.6 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 200 TYFNNFFAFLPTIFTWHF 147 +Y ++ FA + TIF W F Sbjct: 206 SYNSDIFAMIGTIFLWLF 223 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/17 (47%), Positives = 11/17 (64%), Gaps = 1/17 (5%) Frame = +3 Query: 36 FTT-TPLADHSVHWWRY 83 FTT TP+ ++ WW Y Sbjct: 152 FTTYTPVCEYDHTWWPY 168 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 6.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 150 VPRKNGRKERKKVVKICERTYTYSFK 227 V R+ KER +CER + +S K Sbjct: 137 VHRRIHTKERPYKCDVCERAFEHSGK 162 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 8.6 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 151 CHVKMVGRNAKKLLKYVSELTPIHSRNYGTAKRVLAT 261 C ++ A L +Y + PI+ T KRVLAT Sbjct: 120 CTASILNLCAIALDRYWAITDPINYAQKRTLKRVLAT 156 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 8.6 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 151 CHVKMVGRNAKKLLKYVSELTPIHSRNYGTAKRVLAT 261 C ++ A L +Y + PI+ T KRVLAT Sbjct: 120 CTASILNLCAIALDRYWAITDPINYAQKRTLKRVLAT 156 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 8.6 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 151 CHVKMVGRNAKKLLKYVSELTPIHSRNYGTAKRVLAT 261 C ++ A L +Y + PI+ T KRVLAT Sbjct: 120 CTASILNLCAIALDRYWAITDPINYAQKRTLKRVLAT 156 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,761 Number of Sequences: 438 Number of extensions: 3168 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16317903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -