BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B01 (530 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 21 5.1 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 6.8 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 21.4 bits (43), Expect = 5.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 368 LKLFTLKYLVIGFHVGKSVISSKHIPSIFKKTVCHL 475 ++L L YL++ GKS+ + I + FK T+ L Sbjct: 1 MRLNMLIYLIVACCWGKSLSIPQQILNEFKSTLLPL 36 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.0 bits (42), Expect = 6.8 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = -2 Query: 472 MTYRFLKNTWNMLRTYYRFPHMKTYN*IF*SK*FQSLKALCD 347 M+YR +N L+ Y+ H + + + F + CD Sbjct: 1 MSYRLSRNDIRFLKVMYKLSHFLSITPNYDFENFVIISPRCD 42 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,104 Number of Sequences: 336 Number of extensions: 2030 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -