BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B01 (530 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC330.05c |ura4||orotidine 5'-phosphate decarboxylase Ura4 |Sc... 53 2e-08 SPAP7G5.06 |||amino acid permease, unknown 4|Schizosaccharomyces... 25 9.3 >SPCC330.05c |ura4||orotidine 5'-phosphate decarboxylase Ura4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 264 Score = 53.2 bits (122), Expect = 2e-08 Identities = 22/51 (43%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = +3 Query: 9 IQLTPGVQLESSKDSLGQVYNTPEKVILENGADVVVVGRGIV-AAKSPEIK 158 I ++PG+ L+ D LGQ Y TPE+VI+ G+D+++VGRG+ A ++P ++ Sbjct: 195 ITMSPGIGLDVKGDGLGQQYRTPEEVIVNCGSDIIIVGRGVYGAGRNPVVE 245 >SPAP7G5.06 |||amino acid permease, unknown 4|Schizosaccharomyces pombe|chr 1|||Manual Length = 583 Score = 24.6 bits (51), Expect = 9.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 392 LVIGFHVGKSVISSKHIPSIFK 457 +VI F +G + HIPS+ K Sbjct: 527 IVIAFFIGYKIYDRSHIPSLSK 548 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,852,807 Number of Sequences: 5004 Number of extensions: 33017 Number of successful extensions: 81 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 218398248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -