BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_B01 (530 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z35641-4|CAA84708.1| 497|Caenorhabditis elegans Hypothetical pr... 42 2e-04 Z29443-13|CAA82579.1| 497|Caenorhabditis elegans Hypothetical p... 42 2e-04 >Z35641-4|CAA84708.1| 497|Caenorhabditis elegans Hypothetical protein T07C4.1 protein. Length = 497 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/48 (35%), Positives = 29/48 (60%) Frame = +3 Query: 6 LIQLTPGVQLESSKDSLGQVYNTPEKVILENGADVVVVGRGIVAAKSP 149 L+ TPGV L++ DS GQ + ++ I D+++VGRG+ ++ P Sbjct: 428 LLNWTPGVNLDAKSDSAGQQWRGVDEAIEVQQNDIIIVGRGVTSSSEP 475 >Z29443-13|CAA82579.1| 497|Caenorhabditis elegans Hypothetical protein T07C4.1 protein. Length = 497 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/48 (35%), Positives = 29/48 (60%) Frame = +3 Query: 6 LIQLTPGVQLESSKDSLGQVYNTPEKVILENGADVVVVGRGIVAAKSP 149 L+ TPGV L++ DS GQ + ++ I D+++VGRG+ ++ P Sbjct: 428 LLNWTPGVNLDAKSDSAGQQWRGVDEAIEVQQNDIIIVGRGVTSSSEP 475 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,836,761 Number of Sequences: 27780 Number of extensions: 172957 Number of successful extensions: 484 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1049512662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -