BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A23 (479 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory pro... 21 7.8 AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical pro... 21 7.8 >DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory protein 2 protein. Length = 122 Score = 20.6 bits (41), Expect = 7.8 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +1 Query: 145 SRFDNLNYSLVLDHEFQFDCQ*NFLLLSLNCRPSWLVLR 261 +++DN++ +L ++ FD LL C +LR Sbjct: 23 TKYDNVDIDAILHNKRLFDNYLQCLLKKGKCNEEAAILR 61 >AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical protein protein. Length = 122 Score = 20.6 bits (41), Expect = 7.8 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +1 Query: 145 SRFDNLNYSLVLDHEFQFDCQ*NFLLLSLNCRPSWLVLR 261 +++DN++ +L ++ FD LL C +LR Sbjct: 23 TKYDNVDIDAILHNKRLFDNYLQCLLKKGKCNEEAAILR 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,204 Number of Sequences: 336 Number of extensions: 1572 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -