BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A18 (422 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual 27 1.6 SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces p... 26 2.1 SPBC23G7.16 |ctr6||vacuolar copper transporter Ctr6 |Schizosacch... 25 3.7 SPBC660.14 |mik1||mitotic inhibitor kinase Mik1|Schizosaccharomy... 25 4.8 SPAC2E1P5.04c |cwg2|orb7|geranylgeranyltransferase I beta subuni... 25 4.8 SPBC1A4.10c |pmc1|SPBP23A10.01c, med14|mediator complex subunit ... 25 4.8 SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual 25 6.4 SPCC74.01 |sly1||SNARE binding protein Sly1|Schizosaccharomyces ... 25 6.4 SPAC1F3.03 |||Lgl family protein|Schizosaccharomyces pombe|chr 1... 25 6.4 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 24 8.5 SPBC2F12.03c |||EST1 family protein|Schizosaccharomyces pombe|ch... 24 8.5 SPAC16.05c |sfp1||transcription factor Sfp1 |Schizosaccharomyces... 24 8.5 >SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual Length = 4717 Score = 26.6 bits (56), Expect = 1.6 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +3 Query: 117 RETARKFVHLVNYTHTDLPRNVRQGLTLVTKHMSFAADSLLKTV 248 ++T KFV + N+ HTDL + +T +SF L++ + Sbjct: 916 KKTGHKFVRINNHEHTDLQEYIGTYVTDDNGSLSFREGVLVEAL 959 >SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1323 Score = 26.2 bits (55), Expect = 2.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 133 NSCISSTTPTRTCLETYAKA*RLLPSTCLL 222 NSC S+T+ TR C + Y+ R+ + C L Sbjct: 1241 NSCNSTTSNTRICEKCYSLVPRMSCTFCCL 1270 >SPBC23G7.16 |ctr6||vacuolar copper transporter Ctr6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 148 Score = 25.4 bits (53), Expect = 3.7 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 188 LAYVSRQVRVGVVDEMHEFPRGFPGQQHDQLLERGGAGLVLG--FRL 54 L Y+ ++R + EF RG+ GQQ + LL L G FRL Sbjct: 50 LGYLFERLRSFTSLKETEFQRGYAGQQSEGLLTHHSKSLKSGRPFRL 96 >SPBC660.14 |mik1||mitotic inhibitor kinase Mik1|Schizosaccharomyces pombe|chr 2|||Manual Length = 581 Score = 25.0 bits (52), Expect = 4.8 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Frame = +3 Query: 126 ARKFVHLVNYTHTDL-PRNVRQGLTLVTK--HMSFAADSLLKTVPVETAMVEIKG 281 A F+HL+ + H D+ P NV L+T+ ++ L ++PV ++MV+++G Sbjct: 404 ALNFIHLLEFVHLDVKPSNV-----LITRDGNLKLGDFGLATSLPV-SSMVDLEG 452 >SPAC2E1P5.04c |cwg2|orb7|geranylgeranyltransferase I beta subunit Cwg2|Schizosaccharomyces pombe|chr 1|||Manual Length = 355 Score = 25.0 bits (52), Expect = 4.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 81 GGLGSRVQVGLETSIAPWLLSKLAL 7 GGL R ++T A W+LS L L Sbjct: 249 GGLNGRTNKDVDTCYAYWVLSSLKL 273 >SPBC1A4.10c |pmc1|SPBP23A10.01c, med14|mediator complex subunit Pmc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 879 Score = 25.0 bits (52), Expect = 4.8 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -3 Query: 411 VHTLTAVLSSHVLRFPRGKWRGVQDRSWMWIVTAVIE 301 +H + S L F +GKWR +D +W++ +E Sbjct: 489 LHAVQGYYSFPYLTFSKGKWR--KDGDSLWVLAYNVE 523 >SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual Length = 478 Score = 24.6 bits (51), Expect = 6.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 298 WSFSFQPLISTIAVSTGTVLRRE 230 + FSF L S ++V +GTVL ++ Sbjct: 275 YGFSFNYLDSVVSVRSGTVLNKQ 297 >SPCC74.01 |sly1||SNARE binding protein Sly1|Schizosaccharomyces pombe|chr 3|||Manual Length = 639 Score = 24.6 bits (51), Expect = 6.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 271 RSKAGRKNSKFYYSSYNPHPRPIL 342 R K N+K + S NP PRPIL Sbjct: 227 RLKDHLMNTKDAFVSVNPKPRPIL 250 >SPAC1F3.03 |||Lgl family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1004 Score = 24.6 bits (51), Expect = 6.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 34 SYTRL*ANLNPRTKPAPPRSRSWSCC 111 +YT + N P+T+ P RS W CC Sbjct: 293 TYTPMQRN-PPKTELEPIRSMRWCCC 317 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 24.2 bits (50), Expect = 8.5 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 396 AVLSSHVLRFPRGKWRGVQDRSWM-WIVTAVIEFGV-FPS 283 AV S++LR KW +SWM W+ ++ E + FPS Sbjct: 127 AVYMSNLLRNVEQKWIQFLHKSWMKWLHISIQESQLTFPS 166 >SPBC2F12.03c |||EST1 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 24.2 bits (50), Expect = 8.5 Identities = 9/34 (26%), Positives = 21/34 (61%) Frame = +3 Query: 168 LPRNVRQGLTLVTKHMSFAADSLLKTVPVETAMV 269 L +++R GL+ + +SF ++ +T P ++ +V Sbjct: 595 LTKDIRTGLSQIFNRLSFFLENTNQTAPDDSVLV 628 >SPAC16.05c |sfp1||transcription factor Sfp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 442 Score = 24.2 bits (50), Expect = 8.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 Query: 70 FSGSGWLRDEYSSLAFVQAS 11 FSG WLRD SL+ V S Sbjct: 42 FSGQAWLRDTIPSLSNVVES 61 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,879,113 Number of Sequences: 5004 Number of extensions: 38708 Number of successful extensions: 127 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 150383836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -