BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A17 (559 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33973| Best HMM Match : ABC_tran (HMM E-Value=0) 31 0.48 SB_35638| Best HMM Match : Upf2 (HMM E-Value=2.1e-17) 31 0.84 SB_5811| Best HMM Match : IKI3 (HMM E-Value=0.0021) 29 2.6 SB_35440| Best HMM Match : p450 (HMM E-Value=2.2e-35) 29 2.6 SB_56457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_4050| Best HMM Match : VPEP (HMM E-Value=3.6) 29 3.4 SB_49777| Best HMM Match : Peptidase_C1 (HMM E-Value=0) 28 4.5 SB_25423| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_18971| Best HMM Match : PWP2 (HMM E-Value=4) 28 5.9 SB_7095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_36243| Best HMM Match : 7tm_2 (HMM E-Value=2.2e-09) 27 7.9 >SB_33973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1184 Score = 31.5 bits (68), Expect = 0.48 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -2 Query: 234 GSTAGSSPVRASAAYPLARSQAWCKSLAASVPDTAWMHACLNGVISNN 91 GS S + S PLA + +CK A VP+T W+ +G I N Sbjct: 449 GSGKTSLLLTISGELPLASGELYCKGRVAYVPETPWL---FSGTIKEN 493 >SB_35638| Best HMM Match : Upf2 (HMM E-Value=2.1e-17) Length = 1420 Score = 30.7 bits (66), Expect = 0.84 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +2 Query: 347 QSNEQSYKDLVMPLITQLVDNLKSKQITD 433 + N+Q Y+DL +P+ + L N++ KQ+ + Sbjct: 293 KGNKQQYRDLEIPISSDLAANMREKQVAE 321 >SB_5811| Best HMM Match : IKI3 (HMM E-Value=0.0021) Length = 567 Score = 29.1 bits (62), Expect = 2.6 Identities = 24/69 (34%), Positives = 29/69 (42%) Frame = -1 Query: 343 SFEGDDNICLLVWHFELINVSDGVRLVRVGAAHASVRQHSRQQSREGQRRVSSRQVTGLV 164 SF DD+ C + W DG V A+ + R SREG SS +V GL Sbjct: 190 SFPWDDHHCRISWR------GDGQYFVVSAIEPATDARKLRVWSREGVLMTSSEEVDGLE 243 Query: 163 QVLSGVCSG 137 Q L SG Sbjct: 244 QSLCWKPSG 252 >SB_35440| Best HMM Match : p450 (HMM E-Value=2.2e-35) Length = 806 Score = 29.1 bits (62), Expect = 2.6 Identities = 35/146 (23%), Positives = 57/146 (39%), Gaps = 4/146 (2%) Frame = +2 Query: 35 PPACEQVFGGISPLRPISLLLDITPFRQACIHAV---SGTDAAKDLHQACDLARGYAALA 205 PP C Q + + PLR + + I I V + K + L G Sbjct: 238 PPECAQYYSPVQPLRSCAEFIMIAEAALVFIAVVVLANLVSLIKRKLSSLHLPPGPQPYP 297 Query: 206 LTGLLPAVL-PDACVRCTDADKPHAIGDVYQLKVPNKQADIVVSFETTQSNEQSYKDLVM 382 L G LP ++ P + T+ K + G +Y L +P +Q ++ S E + + KD Sbjct: 298 LVGNLPHLVGPLMPLAMTELAKKY--GKIYSLTLPGQQCVVLNSSELAREALLTRKDEFS 355 Query: 383 PLITQLVDNLKSKQITDIKIYLAGHT 460 + V + ++ D I A HT Sbjct: 356 GRPSTFVGDFITRSSAD--IICADHT 379 >SB_56457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 28.7 bits (61), Expect = 3.4 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = +2 Query: 296 LKVPNKQADIVVSFETTQSNEQSYKDLVMPLITQLVDNLKSKQITDIKIYLAGHT 460 ++V D+V FET +NE + + P V L K D K GHT Sbjct: 1 MEVEKSPTDVVQEFETLAANEVKKERRIAPGEAHFVWKLIQKHGEDYKAERLGHT 55 >SB_4050| Best HMM Match : VPEP (HMM E-Value=3.6) Length = 569 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 58 RRNLPTSANQSIIRYHTIQTSVHPRGVRNRRR 153 RRNLPT N S I + T R R RRR Sbjct: 197 RRNLPTHDNTSTITPEAVATQAPQRRRRRRRR 228 >SB_49777| Best HMM Match : Peptidase_C1 (HMM E-Value=0) Length = 298 Score = 28.3 bits (60), Expect = 4.5 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 6 TPTTRCTLLCHQPVNRCSEESPHFGQSVY 92 +PT +C C N + HFGQS Y Sbjct: 206 SPTPKCERKCEAGYNVSYSDDKHFGQSAY 234 >SB_25423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 528 Score = 27.9 bits (59), Expect = 5.9 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Frame = +2 Query: 416 SKQITDIKI-YLAGHTSKYPYPILYDTDLK-LKELQTT 523 S+QIT + LA +SK+P+P+L D L+ LK + +T Sbjct: 2 SEQITCFLLPVLATPSSKFPFPVLVDAVLRMLKSMSST 39 >SB_18971| Best HMM Match : PWP2 (HMM E-Value=4) Length = 400 Score = 27.9 bits (59), Expect = 5.9 Identities = 18/67 (26%), Positives = 29/67 (43%) Frame = +2 Query: 191 YAALALTGLLPAVLPDACVRCTDADKPHAIGDVYQLKVPNKQADIVVSFETTQSNEQSYK 370 Y AL +T D C+ + D AIGD ++VP K+ DI S N + Sbjct: 20 YKALTVTHKQSFKYNDTCLNYSSKDVVMAIGDA--IEVPLKEEDISTSHPLPSYNPNAPP 77 Query: 371 DLVMPLI 391 +++ + Sbjct: 78 KIIVKFV 84 >SB_7095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -2 Query: 213 PVRASAAYPLARSQAWCKSLAASVPDTAWMHACLNGVISNNRL 85 P +SA +PLA +Q ++ + VP + +H +NG N + Sbjct: 31 PWASSAGWPLAINQDNSSNINSLVPSISVLHISVNGEFHENNV 73 >SB_36243| Best HMM Match : 7tm_2 (HMM E-Value=2.2e-09) Length = 1338 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 36 HQPVNRCSEESPHFGQSVYY*ISHHSDKRASTRCPEQTPL 155 H+P++ S F + + ++K S CPEQTP+ Sbjct: 684 HKPISPHGLSSKDFSLIFDFGENSRAEKTVSINCPEQTPI 723 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,422,992 Number of Sequences: 59808 Number of extensions: 344283 Number of successful extensions: 1084 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1084 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -