BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A16 (487 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 24 0.64 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 1.9 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 2.6 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 4.5 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 24.2 bits (50), Expect = 0.64 Identities = 17/61 (27%), Positives = 22/61 (36%) Frame = +2 Query: 131 PCNAFGGKCTEAETDCPAGTHITAKGLCPSQQHRGVECCHSVLRKINTCRSHGGECMDRC 310 PC G C + D KG S + C H+ + TC+ G M RC Sbjct: 114 PCRN-NGSCVDRIADFECNCKNGWKGKTCSLKDS--HCDHTTCKNGGTCQDLGKTFMCRC 170 Query: 311 P 313 P Sbjct: 171 P 171 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 155 CTEAETDCPAGTHITAKGL 211 C EAE PAG H+ K + Sbjct: 296 CQEAERLGPAGVHLRKKNI 314 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 245 NILRPYAVDLDKDLSQ*CEYQPDSPFQLRYT 153 N+L + D DLS+ ++QP +R+T Sbjct: 445 NVLSTFWQQSDLDLSRGLDFQPRGSVFVRFT 475 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.4 bits (43), Expect = 4.5 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 149 GKCTEAETDCPAGTHITAKGLCPSQQHRGVECCHSVLRKI 268 GKCT+ G T K C + + E H V + + Sbjct: 49 GKCTKEAEKLKKGITETMKNGCVKCEQKQKEDVHKVFQHL 88 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,985 Number of Sequences: 336 Number of extensions: 1927 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11315916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -