BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A16 (487 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_48128| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 30 0.88 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 30 0.88 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 30 0.88 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 30 0.88 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 30 0.88 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 30 0.88 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 30 0.88 SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 30 0.88 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 30 0.88 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 30 1.2 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.2 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 30 1.2 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.2 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.2 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.2 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 30 1.2 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 30 1.2 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.2 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_50119| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 29 2.7 SB_162| Best HMM Match : Extensin_2 (HMM E-Value=0.79) 29 2.7 SB_46902| Best HMM Match : GYR (HMM E-Value=1.1) 29 2.7 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_17658| Best HMM Match : GAS2 (HMM E-Value=6.9e-09) 29 2.7 SB_13995| Best HMM Match : ASC (HMM E-Value=0.0034) 29 2.7 SB_51815| Best HMM Match : RVT_1 (HMM E-Value=0.23) 28 3.6 SB_37253| Best HMM Match : Atrophin-1 (HMM E-Value=0.68) 28 3.6 SB_35314| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_41536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) 28 4.7 SB_7465| Best HMM Match : RHH_1 (HMM E-Value=6.7) 28 4.7 SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) 27 6.2 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 27 6.2 SB_18957| Best HMM Match : zf-TAZ (HMM E-Value=3.7) 27 6.2 SB_4480| Best HMM Match : TAT_ubiq (HMM E-Value=8.2) 27 6.2 SB_57935| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) 27 6.2 SB_50619| Best HMM Match : RnaseH (HMM E-Value=0.89) 27 6.2 SB_46562| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 27 6.2 SB_16363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_51888| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_51705| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 27 8.2 SB_43838| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_34139| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_24999| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_20893| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-23) 27 8.2 SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 27 8.2 SB_56836| Best HMM Match : GAF (HMM E-Value=2.8e-07) 27 8.2 SB_54293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 27 8.2 SB_50082| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_44853| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 27 8.2 SB_26734| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_26387| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_26286| Best HMM Match : DUF963 (HMM E-Value=0.82) 27 8.2 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 27 8.2 SB_2527| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 32.7 bits (71), Expect = 0.16 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 467 PSCRIRYQAYRYRRPR 420 P CR YQAYRYRRPR Sbjct: 110 PHCRHVYQAYRYRRPR 125 >SB_48128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 30.7 bits (66), Expect = 0.67 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -3 Query: 485 GQRRLKPSCRIR-YQAYRYRRPR 420 GQR + C++ +QAYRYRRPR Sbjct: 30 GQRCMDTYCKVHLHQAYRYRRPR 52 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 10 LEVDGIDKLDIEF 22 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 28 LEVDGIDKLDIEF 40 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 53 LEVDGIDKLDIEF 65 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 25 LEVDGIDKLDIEF 37 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 10 LEVDGIDKLDIEF 22 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) Length = 163 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 24 LEVDGIDKLDIEF 36 >SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) Length = 158 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 25 LEVDGIDKLDIEF 37 >SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 28 LEVDGIDKLDIEF 40 >SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 12 LEVDGIDKLDIEF 24 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 24 LEVDGIDKLDIEF 36 >SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 61 LEVDGIDKLDIEF 73 >SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 68 EFDIKLIDTVDLE 80 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 117 EFDIKLIDTVDLE 129 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) Length = 119 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.9 bits (64), Expect = 1.2 Identities = 24/73 (32%), Positives = 29/73 (39%), Gaps = 1/73 (1%) Frame = +2 Query: 155 CTEAETDCPAGTHI-TAKGLCPSQQHRGVECCHSVLRKINTCRSHGGECMDRCPENLTYK 331 C+E CP K CPS ECC +VL + +SH C C E+ Sbjct: 1304 CSEHSNACPQECSTDNCKPSCPS------ECCLTVLTPLKENKSHQEGCPAVCSESC--- 1354 Query: 332 NADDCNIKNKICC 370 DC IK CC Sbjct: 1355 -KPDCPIK---CC 1363 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/52 (32%), Positives = 20/52 (38%) Frame = +2 Query: 155 CTEAETDCPAGTHITAKGLCPSQQHRGVECCHSVLRKINTCRSHGGECMDRC 310 C + CPA K CP ECC +VL+ I R H C C Sbjct: 1246 CLKDARGCPATCVEDCKPGCPP------ECCFAVLKPIQENREHSQSCPKIC 1291 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_50119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 26 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 458 RIRYQAYRYRRPR 420 R+ YQAYRYRRPR Sbjct: 3 RLAYQAYRYRRPR 15 >SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 481 KGD*NPRAEFDIKLIDTVDLE 419 K + NP + DIKLIDTVDLE Sbjct: 2 KDNNNPVRKVDIKLIDTVDLE 22 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 2.0 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LE+DGIDKLDIEF Sbjct: 10 LELDGIDKLDIEF 22 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 466 PRAEFDIKLIDTVDLE 419 P A+F IKLIDTVDLE Sbjct: 38 PSADFWIKLIDTVDLE 53 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 470 KPSCRIRYQAYRYRRPR 420 K ++R+QAYRYRRPR Sbjct: 96 KDEQQLRHQAYRYRRPR 112 >SB_162| Best HMM Match : Extensin_2 (HMM E-Value=0.79) Length = 820 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -3 Query: 251 NDNILRPYAVDLDKDLSQ*CEYQPDSPFQLRYTSRRTHYKVVRR 120 +D L+P VD +K++++ CE Q SP RR + +R+ Sbjct: 688 SDQALKPNNVDENKNITRDCELQMKSPSATSLEDRRQEEEELRQ 731 >SB_46902| Best HMM Match : GYR (HMM E-Value=1.1) Length = 54 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -3 Query: 455 IRYQAYRYRRPR 420 IR+QAYRYRRPR Sbjct: 32 IRHQAYRYRRPR 43 >SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 422 EVDGIDKLDIEF 457 EVDGIDKLDIEF Sbjct: 26 EVDGIDKLDIEF 37 >SB_17658| Best HMM Match : GAS2 (HMM E-Value=6.9e-09) Length = 959 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -3 Query: 251 NDNILRPYAVDLDKDLSQ*CEYQPDSPFQLRYTSRRTHYKVVRR 120 +D L+P VD +K++++ CE Q SP RR + +R+ Sbjct: 827 SDQALKPNNVDENKNITRDCELQMKSPSATSLEDRRQEEEELRQ 870 >SB_13995| Best HMM Match : ASC (HMM E-Value=0.0034) Length = 610 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 257 LRKINTCRSHGG-ECMDRCPENLTYKNA 337 L ++N GG +C+++CP+ TYK A Sbjct: 104 LNRVNMMYQEGGLKCLEKCPQPCTYKFA 131 >SB_51815| Best HMM Match : RVT_1 (HMM E-Value=0.23) Length = 297 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +2 Query: 311 PENLTYKNADDCNIKNK-ICCIL 376 PE L +N DDC I NK + C+L Sbjct: 254 PEKLNARNRDDCEIHNKTLTCML 276 >SB_37253| Best HMM Match : Atrophin-1 (HMM E-Value=0.68) Length = 1113 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 455 IRYQAYRYRRPR 420 I YQAYRYRRPR Sbjct: 591 IMYQAYRYRRPR 602 >SB_35314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 458 RIRYQAYRYRRPR 420 R+R QAYRYRRPR Sbjct: 19 RVRDQAYRYRRPR 31 >SB_41536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +2 Query: 419 LEVDGIDKLDIEFGTRVLVS 478 LEVDGIDKLDI V VS Sbjct: 10 LEVDGIDKLDITTSAPVQVS 29 >SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) Length = 197 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +2 Query: 419 LEVDGIDKLDIEFGTRVLVS 478 LEVDGIDKLD+ V+VS Sbjct: 23 LEVDGIDKLDVSKYALVIVS 42 >SB_7465| Best HMM Match : RHH_1 (HMM E-Value=6.7) Length = 71 Score = 27.9 bits (59), Expect = 4.7 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 452 RYQAYRYRRPR 420 +YQAYRYRRPR Sbjct: 57 KYQAYRYRRPR 67 >SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 27.5 bits (58), Expect = 6.2 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +2 Query: 419 LEVDGIDKLDIEF 457 LEVDGIDKLD+++ Sbjct: 23 LEVDGIDKLDVQY 35 >SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 675 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 236 VECCHSVLRKINTCRSHGGECMDRC-PENLTYKNADDC 346 V C V+R++ TC + G C D PE + DC Sbjct: 578 VTCGEGVVRRVVTCSAGGNRCQDDTKPEVVKLCELPDC 615 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 27.5 bits (58), Expect = 6.2 Identities = 19/75 (25%), Positives = 28/75 (37%), Gaps = 2/75 (2%) Frame = +2 Query: 128 QPCNAFGGKCTEA--ETDCPAGTHITAKGLCPSQQHRGVECCHSVLRKINTCRSHGGECM 301 Q C + G +A + DCP + +G C + R +C + G +C Sbjct: 1573 QKCECYPGWAGDACDKLDCPGSPPCSGQGECSNTNPRRCQCFP---------KWGGEKCE 1623 Query: 302 DRCPENLTYKNADDC 346 C Y NA DC Sbjct: 1624 IPCLNGYNYGNASDC 1638 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 467 PSCRIRYQAYRYRRPR 420 P YQAYRYRRPR Sbjct: 21 PILHQNYQAYRYRRPR 36 >SB_18957| Best HMM Match : zf-TAZ (HMM E-Value=3.7) Length = 117 Score = 27.5 bits (58), Expect = 6.2 Identities = 20/76 (26%), Positives = 35/76 (46%) Frame = +2 Query: 71 INQSNGVIEPSKATLVYDEQPCNAFGGKCTEAETDCPAGTHITAKGLCPSQQHRGVECCH 250 +N +I + + +V+D+Q GG+C A D +H G C + H G +C Sbjct: 11 VNGGQWLIAQAASVIVHDDQCVIVHGGQCMIAHGDRCTVSH---SGRC-TVAHGG-QCV- 64 Query: 251 SVLRKINTCRSHGGEC 298 ++ +HGG+C Sbjct: 65 -IVHGSQCVIAHGGQC 79 >SB_4480| Best HMM Match : TAT_ubiq (HMM E-Value=8.2) Length = 107 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 482 QRRLKPSCRIRYQAYRYRRPR 420 ++ LK ++QAYRYRRPR Sbjct: 76 EQHLKTLQNAQHQAYRYRRPR 96 >SB_57935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 Query: 476 RLKPSCRIRYQAYRYRRPR 420 R K + YQAYRYRRPR Sbjct: 18 RNKTTLTGNYQAYRYRRPR 36 >SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) Length = 598 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +2 Query: 419 LEVDGIDKLDIEFGT 463 LEVDGIDKLD GT Sbjct: 94 LEVDGIDKLDFSDGT 108 >SB_50619| Best HMM Match : RnaseH (HMM E-Value=0.89) Length = 724 Score = 27.5 bits (58), Expect = 6.2 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 452 RYQAYRYRRPR 420 +YQAYRYRRPR Sbjct: 431 QYQAYRYRRPR 441 >SB_46562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 75 LIRKTHRKHTKNGRRKH 25 LIR THRKH KN + H Sbjct: 139 LIRSTHRKHCKNEKCTH 155 >SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) Length = 171 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/18 (77%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = -1 Query: 469 NP-RAEFDIKLIDTVDLE 419 NP R F+IKLIDTVDLE Sbjct: 46 NPIRFPFNIKLIDTVDLE 63 >SB_16363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 27.5 bits (58), Expect = 6.2 Identities = 27/107 (25%), Positives = 44/107 (41%), Gaps = 10/107 (9%) Frame = +2 Query: 83 NGVIEPSKATLVYDEQPCNAFGGKCTEAETDCPAGTHITAKGLC-PSQQHRGVECCHSVL 259 N +IE ++ DE C A GG C P +T C PSQ C V Sbjct: 436 NRIIEGNEQCDCGDENSCKAEGGCCN--PPGHPQACRLTLAATCSPSQGPCCGRDCRYVG 493 Query: 260 RKINTCRSHGGECMDR---------CPENLTYKNADDCNIKNKICCI 373 I +CR+ +C+D+ CP+++ + C+ ++C + Sbjct: 494 NDI-SCRNK-TDCLDKAMCSGSSVECPKSVYQPDNTVCDKGRRVCSV 538 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.1 bits (57), Expect = 8.2 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 457 EFDIKLIDTVDLE 419 ++DIKLIDTVDLE Sbjct: 35 KYDIKLIDTVDLE 47 >SB_51888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 87 YQAYRYRRPR 96 >SB_51705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 66 YQAYRYRRPR 75 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 27.1 bits (57), Expect = 8.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 482 QRRLKPSCRIRYQAYRYRRPR 420 QR+ + R + QAYRYRRPR Sbjct: 25 QRKEASASRKQDQAYRYRRPR 45 >SB_43838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 37 YQAYRYRRPR 46 >SB_34139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 29 YQAYRYRRPR 38 >SB_24999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 65 YQAYRYRRPR 74 >SB_20893| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-23) Length = 435 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 14 YQAYRYRRPR 23 >SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.1 bits (57), Expect = 8.2 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -3 Query: 455 IRYQAYRYRRPR 420 +++QAYRYRRPR Sbjct: 111 VKHQAYRYRRPR 122 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 533 YQAYRYRRPR 542 >SB_56836| Best HMM Match : GAF (HMM E-Value=2.8e-07) Length = 552 Score = 27.1 bits (57), Expect = 8.2 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 467 PSCRIRYQAYRYRRPR 420 PS + +QAYRYRRPR Sbjct: 453 PSFQELHQAYRYRRPR 468 >SB_54293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 96 YQAYRYRRPR 105 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 27.1 bits (57), Expect = 8.2 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -1 Query: 469 NPRAEFDIKLIDTVDLE 419 N RA IKLIDTVDLE Sbjct: 56 NKRALVSIKLIDTVDLE 72 >SB_50082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 21 YQAYRYRRPR 30 >SB_44853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 43 YQAYRYRRPR 52 >SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) Length = 128 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 37 YQAYRYRRPR 46 >SB_26734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 94 YQAYRYRRPR 103 >SB_26387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 24 YQAYRYRRPR 33 >SB_26286| Best HMM Match : DUF963 (HMM E-Value=0.82) Length = 167 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 147 YQAYRYRRPR 156 >SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) Length = 236 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 35 YQAYRYRRPR 44 >SB_2527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 449 YQAYRYRRPR 420 YQAYRYRRPR Sbjct: 24 YQAYRYRRPR 33 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,641,851 Number of Sequences: 59808 Number of extensions: 243810 Number of successful extensions: 1114 Number of sequences better than 10.0: 130 Number of HSP's better than 10.0 without gapping: 1044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1114 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1026164244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -