BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A16 (487 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 30 0.037 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 25 1.4 AY994094-1|AAX86007.1| 41|Anopheles gambiae metallothionein 2 ... 24 2.4 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 2.4 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 23 7.3 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 30.3 bits (65), Expect = 0.037 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +2 Query: 71 INQSNGVIEPSKATLVYDEQPCNAFGGKCTEAETDCPAGTHITAKGLC 214 I + +G I ++ ++ + E C A G CT E C + H + +G C Sbjct: 287 ITRYSGQISTTEQSVTHIEGRCKAIGDSCTRHENCCSSNCH-SYRGKC 333 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 25.0 bits (52), Expect = 1.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 143 FGGKCTEAETDCPAGTH 193 +G C+E E DC G H Sbjct: 1146 YGAACSEVEIDCLTGDH 1162 >AY994094-1|AAX86007.1| 41|Anopheles gambiae metallothionein 2 protein. Length = 41 Score = 24.2 bits (50), Expect = 2.4 Identities = 10/39 (25%), Positives = 14/39 (35%) Frame = +2 Query: 131 PCNAFGGKCTEAETDCPAGTHITAKGLCPSQQHRGVECC 247 PC C +C AG ++ CP + CC Sbjct: 2 PCKTCVADCKCTSPNCGAGCGCESRCTCPCKDGAKEGCC 40 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.2 bits (50), Expect = 2.4 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 6/60 (10%) Frame = +2 Query: 212 CPSQQHRG--VECCHSVLRKINTCRSHGGECMDRCPENLTYKNADDC----NIKNKICCI 373 C + +++G ++ C S+ R + G+C C + N D+C N+K+ C+ Sbjct: 492 CKNVKYKGKCLDSCKSLPRLYSVDSKTCGDCHQECKDFCYGPNEDNCGSCMNVKDGRFCV 551 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 22.6 bits (46), Expect = 7.3 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +2 Query: 98 PSKATLVYDEQPCNAFGGKCTEAETDC 178 P+++T EQ C+ E DC Sbjct: 124 PNRSTTASSEQACSGSSSSSPEPNLDC 150 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 426,452 Number of Sequences: 2352 Number of extensions: 8659 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42708759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -