BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A14 (611 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81073-9|CAB03030.2| 583|Caenorhabditis elegans Hypothetical pr... 29 3.5 Z79752-7|CAC70084.1| 583|Caenorhabditis elegans Hypothetical pr... 29 3.5 AL132862-29|CAI79284.1| 109|Caenorhabditis elegans Hypothetical... 29 3.5 >Z81073-9|CAB03030.2| 583|Caenorhabditis elegans Hypothetical protein F30F8.2 protein. Length = 583 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 41 LYLHSTTYVRFIGEKLGEVLAAMAKGGMSPD 133 +YL T+ R+IG +G V A+ K + PD Sbjct: 123 IYLEKDTFKRYIGSSIGVVTKALKKQMIIPD 153 >Z79752-7|CAC70084.1| 583|Caenorhabditis elegans Hypothetical protein F30F8.2 protein. Length = 583 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 41 LYLHSTTYVRFIGEKLGEVLAAMAKGGMSPD 133 +YL T+ R+IG +G V A+ K + PD Sbjct: 123 IYLEKDTFKRYIGSSIGVVTKALKKQMIIPD 153 >AL132862-29|CAI79284.1| 109|Caenorhabditis elegans Hypothetical protein Y73F8A.36 protein. Length = 109 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 22 QLSHPLAVPPFDHVRSVHRREAR*SPRGYGKGRYESRC 135 Q +H ++P F R V RR+AR G+ +G +E+RC Sbjct: 36 QKAHIKSLPKFTEKRKVLRRQARFI--GFQRGFFETRC 71 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,499,366 Number of Sequences: 27780 Number of extensions: 280967 Number of successful extensions: 614 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 613 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -