BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A13 (540 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 37 0.012 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 37 0.012 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.021 SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) 36 0.028 SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) 35 0.037 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 35 0.037 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 35 0.037 SB_15403| Best HMM Match : CH (HMM E-Value=0) 34 0.065 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 34 0.085 SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) 33 0.15 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 32 0.26 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) 31 0.46 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 31 0.60 SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) 31 0.60 SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) 31 0.80 SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) 30 1.1 SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 3.2 SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) 28 4.2 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 28 4.2 SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 28 5.6 SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) 28 5.6 SB_21821| Best HMM Match : MRG (HMM E-Value=0) 28 5.6 SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) 27 7.4 SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) 27 9.8 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 37.5 bits (83), Expect = 0.007 Identities = 24/45 (53%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVK--VTLARQ 532 C +NC ST + PVCGSD KTYKN+ L A C K VT+A Q Sbjct: 3970 CNKNCPSTSK--PVCGSDGKTYKNECELKRAA-CESKKNVTVASQ 4011 Score = 32.7 bits (71), Expect = 0.20 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKN 475 +C C+ P+ PVCG+D KTY+N Sbjct: 4236 ECPSRCL--PDKEPVCGADGKTYRN 4258 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 36.7 bits (81), Expect = 0.012 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKNQ---GRLFCAQN 502 C+ I T EY+P+CGSD KTY NQ R C QN Sbjct: 5152 CSCPDICTFEYSPLCGSDGKTYDNQCEMERASCLQN 5187 Score = 33.5 bits (73), Expect = 0.11 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKNQ 478 C N I T EY PVCG+D ++Y N+ Sbjct: 5222 CTCNSICTLEYAPVCGTDGQSYDNE 5246 Score = 32.7 bits (71), Expect = 0.20 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 416 CISTPEYN-PVCGSDXKTYKNQGRL 487 C S P N PVCGSD KTY N+ L Sbjct: 5621 CQSCPSINKPVCGSDGKTYNNECEL 5645 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 416 CISTPEY-NPVCGSDXKTYKNQGRL 487 C+S P +PVCGSD K Y N+ L Sbjct: 5790 CLSCPNILDPVCGSDGKNYDNECNL 5814 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = +2 Query: 431 EYNPVCGSDXKTYKNQGRL---FCAQNCGVKV 517 +Y PVCG+D +TY+N+ L C +N V+V Sbjct: 5558 DYTPVCGTDGETYENECTLQISSCQRNEQVEV 5589 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 36.7 bits (81), Expect = 0.012 Identities = 20/41 (48%), Positives = 23/41 (56%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVKVTLA 526 C ENC ST + PVCGSD TY N+ L Q C T+A Sbjct: 275 CPENCSSTVD--PVCGSDNNTYDNE-CLMRQQACVANTTVA 312 Score = 35.5 bits (78), Expect = 0.028 Identities = 19/41 (46%), Positives = 23/41 (56%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVKVTLA 526 C ENC ST + PVCG+D TY N+ L Q C T+A Sbjct: 161 CPENCSSTVD--PVCGTDNNTYDNE-CLMRQQACVANATVA 198 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 36.7 bits (81), Expect = 0.012 Identities = 20/41 (48%), Positives = 23/41 (56%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVKVTLA 526 C ENC ST + PVCGSD TY N+ L Q C T+A Sbjct: 1206 CPENCSSTVD--PVCGSDNNTYDNE-CLMRQQACVANTTVA 1243 Score = 35.5 bits (78), Expect = 0.028 Identities = 19/41 (46%), Positives = 23/41 (56%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVKVTLA 526 C ENC ST + PVCG+D TY N+ L Q C T+A Sbjct: 1135 CPENCSSTVD--PVCGTDNNTYDNE-CLMRQQACVANATVA 1172 Score = 30.7 bits (66), Expect = 0.80 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVKVTL 523 +C+E+C T PVCGSD Y N+ L A+ C T+ Sbjct: 1372 ECSEDCPKT--LKPVCGSDNNDYDNE-CLMQARACATNKTI 1409 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 437 NPVCGSDXKTYKNQGRL 487 +PVCGSD KTY N+ R+ Sbjct: 617 DPVCGSDSKTYPNECRM 633 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKNQ---GRLFCAQNCGVKVTLAR 529 C ++C T E P+C SD +TY N+ + C N + VT R Sbjct: 2154 CPDDC--TNETKPICASDGQTYDNECLMQKRACENNQNLNVTSDR 2196 Score = 28.7 bits (61), Expect = 3.2 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKNQGRL---FCAQNCGVKVTLARQ 532 C +C P+CGS+ KTY N+ L C N + + ++ Sbjct: 289 CPSSCGDESLPQPICGSNNKTYANECELRMDSCKNNKSIAIQFRKE 334 >SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 35.9 bits (79), Expect = 0.021 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +2 Query: 425 TPEYNPVCGSDXKTYKNQGRL---FCAQNCGVKVTLARQAR 538 T +YNPVCGSD +TY N+ + C +N +K+ + R Sbjct: 15 TADYNPVCGSDGRTYPNRASMEVQGCLKNTVLKIVSQGECR 55 >SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) Length = 143 Score = 35.5 bits (78), Expect = 0.028 Identities = 19/41 (46%), Positives = 23/41 (56%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVKVTLA 526 C ENC ST + PVCG+D TY N+ L Q C T+A Sbjct: 27 CPENCSSTVD--PVCGTDNNTYDNE-CLMRQQACVANATVA 64 >SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) Length = 77 Score = 35.1 bits (77), Expect = 0.037 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 401 KCAEN-CISTPEYNPVCGSDXKTYKNQGRLFCAQNC 505 KC ++ + T +Y+PVCGSD KTY N L A C Sbjct: 24 KCDDSPTLCTLQYDPVCGSDGKTYGNMCFLKAAIKC 59 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 35.1 bits (77), Expect = 0.037 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = +2 Query: 389 QTIEKCAENCISTPEYNPVCGSDXKTYKN 475 Q + C E C T EY PVCGSD KTY N Sbjct: 37 QPVCVCNEAC--TREYAPVCGSDGKTYPN 63 Score = 32.7 bits (71), Expect = 0.20 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKN 475 +C + C T +Y PVCGSD KTY N Sbjct: 195 ECPKVC--TLDYTPVCGSDNKTYAN 217 Score = 32.3 bits (70), Expect = 0.26 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNC--GVKVTLA 526 +C + C T EY P CG+D TY N+ + Q+C G K+ LA Sbjct: 278 ECPKAC--TREYKPACGTDGNTYPNR-CVLAIQSCETGEKLQLA 318 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKN 475 +C C T E PVCG+D KTY N Sbjct: 117 ECPRAC--TRELMPVCGTDQKTYDN 139 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 35.1 bits (77), Expect = 0.037 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKN 475 +C C T E NPVCGSD KTY N Sbjct: 117 RCMRRC--TKELNPVCGSDGKTYDN 139 Score = 31.1 bits (67), Expect = 0.60 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 398 EKCAENCISTPEYNPVCGSDXKTYKN 475 +KCA C Y PVCGSD TY N Sbjct: 167 DKCAPIC--NKMYQPVCGSDNVTYSN 190 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 395 IEKCAENCISTPEYNPVCGSDXKTYKNQGRLFCA 496 ++ C C + Y PVCG+D KTY N+ L A Sbjct: 41 VDPCVRPCPAI--YMPVCGTDGKTYGNKCMLGAA 72 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 34.3 bits (75), Expect = 0.065 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKN 475 KC + T EY PVCGSD TY N Sbjct: 721 KCVCSAACTREYAPVCGSDGNTYNN 745 Score = 33.5 bits (73), Expect = 0.11 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVKVTLAR 529 +C + P Y+P+CG+D KTY N L A C + ++ R Sbjct: 1232 RCECDLRPDPAYDPICGTDGKTYNNDKDLESAA-CAQQTSIVR 1273 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 33.9 bits (74), Expect = 0.085 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +2 Query: 389 QTIEKCAENCISTPEYNPVCGSDXKTYKNQGRL---FCAQNCGVKV 517 Q + +C C T EY PVCGSD KTY + + C++N +KV Sbjct: 42 QPVCECPMAC--TREYAPVCGSDGKTYPTECVMQVDACSKNKDIKV 85 >SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) Length = 92 Score = 33.1 bits (72), Expect = 0.15 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 395 IEKCAENCISTPEYNPVCGSDXKTYKNQ 478 I +C N T Y PVCG+D KTY N+ Sbjct: 34 IVRCVCNRACTKIYRPVCGTDGKTYGNK 61 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 33.1 bits (72), Expect = 0.15 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVKVTLARQAR 538 +C E C S E +PVCG+D +TY ++ L A+ G KV + + R Sbjct: 205 RCHEPCPS--EASPVCGTDMRTYASRCHLQLAKCKGHKVKMIYKGR 248 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 32.3 bits (70), Expect = 0.26 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = +2 Query: 431 EYNPVCGSDXKTYKNQGRL---FCAQNCGVKV 517 E +PVCGSD KTY+N+ +L C N V++ Sbjct: 516 EASPVCGSDGKTYENECKLRVESCKANQNVRI 547 Score = 30.7 bits (66), Expect = 0.80 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 386 RQTIEKCAENCISTPEYNPVCGSDXKTYKNQGRLFC-AQNCGVKVTLARQ 532 RQ + C ++ PVCGSD +TY N RL G VT+ RQ Sbjct: 430 RQAVCACPRFEDCPRDFRPVCGSDLRTYVNLCRLQVEVCQTGRAVTVLRQ 479 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKN 475 C NC S +++PVCG D TY+N Sbjct: 579 CPTNCPS--DWDPVCGDDGVTYQN 600 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVKVTL 523 KC+ P PVCGSD K+Y ++ L + C K+ L Sbjct: 1679 KCSCPIYCPPSGQPVCGSDGKSYGSECEL-RKEACEAKIKL 1718 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = +2 Query: 425 TPEYNPVCGSDXKTYKNQ---GRLFCAQNCGVKVTLARQAR 538 T +Y PVCG D K+Y + RL C + GV + +A + R Sbjct: 1758 TLKYTPVCGDDGKSYLSTCMLKRLACLK--GVHIAIASKGR 1796 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +2 Query: 434 YNPVCGSDXKTYKNQGRL---FCAQNCGVKV 517 Y+PVCGS+ KTY N L C +N +K+ Sbjct: 1830 YDPVCGSNRKTYLNFCSLTAEACKKNLPIKM 1860 Score = 27.5 bits (58), Expect = 7.4 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 389 QTIEKCAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVKVTL 523 Q I C E C T ++ VCGS+ +TY N L + +C ++ T+ Sbjct: 1886 QAICVCDEKC--TFAFDAVCGSNGRTYIND-CLLRSDSCKLRKTI 1927 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 31.9 bits (69), Expect = 0.34 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKNQ 478 KC C T EY PVCG+D KTY N+ Sbjct: 1294 KCPIFC--TYEYMPVCGTDGKTYGNK 1317 Score = 31.9 bits (69), Expect = 0.34 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKNQ 478 +C ++T EY PVC SD K Y N+ Sbjct: 1966 ECVCRTVTTLEYRPVCASDGKIYPNR 1991 Score = 31.1 bits (67), Expect = 0.60 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKNQ 478 KC + + T +Y PVC SD KTY N+ Sbjct: 1522 KCRQ--MMTADYTPVCASDGKTYPNR 1545 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKNQGRL 487 KC + I +P +PVCGSD K YK+ L Sbjct: 1753 KCPPS-ICSPVISPVCGSDGKIYKDDCEL 1780 Score = 28.7 bits (61), Expect = 3.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 425 TPEYNPVCGSDXKTYKN 475 T +Y+PVC SD +TY N Sbjct: 1818 TADYSPVCASDGQTYPN 1834 Score = 27.9 bits (59), Expect = 5.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDXKTYKNQ 478 +C I Y+PVCGSD Y N+ Sbjct: 1364 QCVCPSICPLHYSPVCGSDGNMYSNE 1389 >SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 31.5 bits (68), Expect = 0.46 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +2 Query: 416 CISTPEYN-PVCGSDXKTYKNQGRL-FCAQNCGVKVTLARQA 535 C+S P+ N PVCGS+ K Y N+ L A +T+AR++ Sbjct: 205 CMSCPKMNKPVCGSNGKDYNNECELQQFACKTNTMITVARRS 246 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 416 CISTPEY-NPVCGSDXKTYKNQGRL 487 C+S P +PVCGSD K Y N+ L Sbjct: 111 CLSCPNILDPVCGSDGKNYDNECNL 135 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 416 CISTPEY-NPVCGSDXKTYKNQGRL 487 C+S P +PVCGSD K Y N +L Sbjct: 274 CLSCPNMLDPVCGSDGKNYDNVCKL 298 >SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) Length = 87 Score = 31.5 bits (68), Expect = 0.46 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +2 Query: 413 NCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVKVTLA 526 NC ST + PVCGSD TY N+ L Q C T+A Sbjct: 2 NCSSTVD--PVCGSDNNTYDNE-CLMRQQACVANTTVA 36 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 31.1 bits (67), Expect = 0.60 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 398 EKCAENCISTPEYNPVCGSDXKTYKN 475 +KCA C Y PVCGSD TY N Sbjct: 24 DKCAPIC--NKMYQPVCGSDNVTYSN 47 >SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) Length = 69 Score = 31.1 bits (67), Expect = 0.60 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 395 IEKCAENCISTPEYN-PVCGSDXKTYKNQGRLFCA 496 ++KC C P N PVCG+D KTY N+ L A Sbjct: 21 VDKCVRPC---PAINDPVCGTDGKTYGNECMLGAA 52 >SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) Length = 85 Score = 30.7 bits (66), Expect = 0.80 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 398 EKCAENCISTPEYNPVCGSDXKTYKN 475 +KCA C Y PVCGSD TY N Sbjct: 38 DKCAPICPKI--YRPVCGSDNVTYSN 61 >SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) Length = 98 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 395 IEKCAENCISTPEYNPVCGSDXKTYKNQ 478 I +C N Y+P+CG+D KTY N+ Sbjct: 34 IARCVCNRACKKIYSPMCGTDGKTYGNK 61 >SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 92 ALLILGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRP 226 A +I GF+ + C +RY Q+ N +N W+ S NRP Sbjct: 6 ATIIRGFLKFRIICEKVRYFTQLRACYN--PQQNKWDTSHTNNRP 48 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNCGVK 514 C +C T Y+PVCG D TY N A C +K Sbjct: 252 CPSDCSHT--YSPVCGGDKTTYINNCTRIAAA-CNMK 285 >SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) Length = 997 Score = 28.3 bits (60), Expect = 4.2 Identities = 24/68 (35%), Positives = 31/68 (45%) Frame = +2 Query: 104 LGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNY 283 LG I SQA NIR Q N +L + N + P+Q GY+ PL +NY Sbjct: 612 LGQITSQAIGSNIR---QDVANVSLPLQMPISNPKTSVPQGGATPMQFGYQGYGPLQHNY 668 Query: 284 NFIAFIFP 307 + IFP Sbjct: 669 GDMNTIFP 676 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 28.3 bits (60), Expect = 4.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 440 PVCGSDXKTYKNQ 478 PVCGSD KTY N+ Sbjct: 1078 PVCGSDGKTYNNE 1090 >SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 28.3 bits (60), Expect = 4.2 Identities = 9/37 (24%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +3 Query: 15 LYLYLCYKICHINYFYY----YNLKWISCARFLYWVL 113 ++L+ +CH+NY Y+ +++ W+ ++Y V+ Sbjct: 121 IWLFHVSLLCHVNYMYHVIWLFHVSWLCHVNYMYHVI 157 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 27.9 bits (59), Expect = 5.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 440 PVCGSDXKTYKNQGRLFCAQNCGVK 514 P+CG D KTY+N LF C K Sbjct: 189 PICGEDEKTYRNL-CLFLVAKCKAK 212 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +2 Query: 440 PVCGSDXKTYKNQGRLFCAQNCGVKVTLARQ 532 PVCGSD KTY N L A+ C + RQ Sbjct: 246 PVCGSDGKTYTNGCELATAK-CALPKGQKRQ 275 >SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) Length = 396 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +2 Query: 401 KCAENCISTPEYNPV-CGSDXKTYKN 475 +CAE+C P Y+ CGSD TYKN Sbjct: 20 ECAESC---PTYDDERCGSDGVTYKN 42 >SB_21821| Best HMM Match : MRG (HMM E-Value=0) Length = 292 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 107 GFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIP 238 G + +A C+ + K E A I NGWNK+ D EW+P Sbjct: 18 GPLIYEAKCIRGQLK---EKTARYLIHYNGWNKNWD----EWVP 54 >SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +2 Query: 401 KCAENCISTPEYNPV-CGSDXKTYKN 475 +CAE+C P Y+ CGSD TYKN Sbjct: 174 ECAESC---PTYDDERCGSDGVTYKN 196 >SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) Length = 1376 Score = 27.5 bits (58), Expect = 7.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 404 CAENCISTPEYNPVC 448 C +CISTP Y+ +C Sbjct: 1196 CVHSCISTPRYDQIC 1210 >SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.1 bits (57), Expect = 9.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 357 HQLLALVEHHDKQLRNARRIAFQHQNTTPC 446 H L AL +++R RRI+++ QNT C Sbjct: 84 HSLPALTFESARKVRQYRRISWEGQNTQTC 113 >SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) Length = 68 Score = 27.1 bits (57), Expect = 9.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDXKTYKN 475 C+ +C PVCGSD TY N Sbjct: 8 CSFSCDDGFHQTPVCGSDDVTYAN 31 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,025,559 Number of Sequences: 59808 Number of extensions: 376272 Number of successful extensions: 1167 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1143 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -