BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A12 (500 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0451 - 25323178-25323241,25323614-25323741,25324533-253246... 27 8.5 02_04_0622 - 24508508-24508666,24509533-24509634,24510108-245101... 27 8.5 01_01_0558 + 4098383-4098510,4100462-4100572,4100765-4100853,410... 27 8.5 >04_04_0451 - 25323178-25323241,25323614-25323741,25324533-25324634, 25325314-25325382,25325489-25325557,25325646-25325720, 25325805-25325909,25326394-25326492,25326626-25328344, 25328629-25328931,25329031-25329129,25329733-25329850, 25329933-25330018,25330091-25330159,25330232-25330306, 25330675-25330772,25331271-25331432,25332391-25332556, 25332902-25332970,25333064-25333126,25333221-25333376, 25334027-25334365 Length = 1410 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 84 VLQTAWVPYLNSLGTRLLRLVTI 152 +L A+VPYL L + LRLVTI Sbjct: 1359 MLGKAFVPYLEGLNSTQLRLVTI 1381 >02_04_0622 - 24508508-24508666,24509533-24509634,24510108-24510176, 24510294-24510362,24510428-24510502,24510584-24510688, 24511309-24511407,24511521-24513230,24513489-24513788, 24514748-24514846,24514962-24515079,24515166-24515251, 24515334-24515402,24515746-24515843,24516373-24516534, 24516779-24516787,24516970-24516991,24517620-24517712, 24517872-24517940,24518720-24518782,24518882-24519037, 24520895-24521230 Length = 1355 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 84 VLQTAWVPYLNSLGTRLLRLVTI 152 +L A+VPYL L + LRLVTI Sbjct: 1315 MLGKAFVPYLEGLNSTQLRLVTI 1337 >01_01_0558 + 4098383-4098510,4100462-4100572,4100765-4100853, 4100974-4101107,4101337-4101435,4102619-4102994, 4103883-4104337,4104419-4107409 Length = 1460 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 243 WTFLKRLSYSPYRKA-NSNRMGRKLISTINRALTLSETIGQ 362 W+F K+ ++ N N +GRK+ S +N ++TIG+ Sbjct: 535 WSFFKQNAFGDANMVDNLNLIGRKIASKLNGIPLAAKTIGK 575 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,859,349 Number of Sequences: 37544 Number of extensions: 233643 Number of successful extensions: 559 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -