BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A11 (319 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 22 4.8 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 21 8.4 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -1 Query: 217 EQNDQQRHDTTQNYVETRHVCDVDENSFKKNL 122 E N+Q R +VE R VC DE+ K L Sbjct: 163 ELNEQIRTYFQNEFVEYRDVCLPDEDHCMKLL 194 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 222 IVNKMISSAMTQPKTTLKP 166 ++ K+ S A+T P LKP Sbjct: 114 VMRKIFSGAITDPTQHLKP 132 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 279,748 Number of Sequences: 2352 Number of extensions: 4009 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 21181083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -