BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A09 (372 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 25 0.22 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 2.0 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 2.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 4.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 6.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 6.2 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 6.2 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 20 8.2 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 20 8.2 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 20 8.2 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 20 8.2 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 20 8.2 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 20 8.2 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 20 8.2 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 20 8.2 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 20 8.2 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 20 8.2 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 20 8.2 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.4 bits (53), Expect = 0.22 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = -1 Query: 285 RRNQHTRHRRLSAVYLCVHSYNYS*HKRCQRTSVSLRSYWRRSVRTSRWYSREDTLSY 112 + N+ T HR + AV + K+ +S SLRS R RTS +SR + L + Sbjct: 182 KTNEITEHRTVLAVNIEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDLRH 239 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 2.0 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +3 Query: 51 VAVSCRPDKPDLKQLKAEAARKKACLHDCTNVKFEPICA-SKNGEKPKSFGSVCVMNNYN 227 V++S P +P ++ ++ + FEP S++ ++ K S NYN Sbjct: 133 VSLSSPPREPGTPRINFTKLKRHHPRYKRPRTTFEPRATDSRHYDRYKEEES---NENYN 189 Query: 228 CEHKDT 245 EHK+T Sbjct: 190 WEHKET 195 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 2.7 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +1 Query: 274 LVPTEFASLNLNYKTSMESFVIYTKHDI 357 ++P ++ LN+ ++E+ +IY DI Sbjct: 200 IIPANYSGWYLNHDYNLENKLIYFIEDI 227 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 4.7 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 78 PDLKQLKAEAARKKACLH-DCTNVKFEPICASKNGE 182 P++++ +++A+ +A L P C+SKNGE Sbjct: 866 PNIEEEASDSAQGRAILKIPSYKPASTPGCSSKNGE 901 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 6.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 238 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 6.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 238 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 6.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 238 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 6.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 238 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.6 bits (41), Expect = 6.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 197 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 227 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 20.6 bits (41), Expect = 6.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 238 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 20.6 bits (41), Expect = 6.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 189 KSFGSVCVMNNYN 227 K+F C +NNYN Sbjct: 150 KNFHPRCAVNNYN 162 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.2 bits (40), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 197 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 227 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.2 bits (40), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 197 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 227 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.2 bits (40), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 20.2 bits (40), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.2 bits (40), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 20.2 bits (40), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 20.2 bits (40), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 207 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 115 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHDFQHTSSRYSRERSCS 238 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 20.2 bits (40), Expect = 8.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 265 PSPTFRSVSLCSQL*LFMT 209 PS + VSLCS + L +T Sbjct: 274 PSDSGEKVSLCSSILLSLT 292 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,962 Number of Sequences: 438 Number of extensions: 2552 Number of successful extensions: 23 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8928360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -