BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A06 (609 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 2.0 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 8.1 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +2 Query: 248 FCWVKVTENWSDSPYQNLAARNVMS*SRVEDSLRNLQSQIYK 373 FC ++ Y+N+ N+ S + D L+NL+ + K Sbjct: 558 FCKMQPLRTLKIGVYRNIKNFNIPSILQFNDGLKNLEIHVTK 599 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.0 bits (42), Expect = 8.1 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -3 Query: 511 GLLAHIFKNMNLLILKQHCCEIKIAIVINDFSIF 410 G+ + F+N N ILK + VI S+F Sbjct: 184 GINTYCFRNDNSEILKMATQLVDFKSVIRSISVF 217 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,226 Number of Sequences: 336 Number of extensions: 2439 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -