BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A06 (609 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein prot... 30 0.051 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 23 7.7 >AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein protein. Length = 163 Score = 30.3 bits (65), Expect = 0.051 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 115 SARIESCRGCSLNRLPQVKRFVMDDAP-NYERLEVKFINGAPP 240 +A +E C C PQ++ F+ D P + L +K++ G P Sbjct: 75 AAVLEVCT-CKFGAYPQIQAFIKSDRPAKFPNLTIKYVRGLDP 116 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +1 Query: 343 IKKSSKSDL*TKMRYCYN 396 +KKS +SDL T +RY ++ Sbjct: 417 LKKSRRSDLRTMIRYMFS 434 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 563,801 Number of Sequences: 2352 Number of extensions: 9757 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -