BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A04 (486 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC582.03 |cdc13||cyclin Cdc13|Schizosaccharomyces pombe|chr 2|... 25 6.1 SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosacch... 25 8.0 >SPBC582.03 |cdc13||cyclin Cdc13|Schizosaccharomyces pombe|chr 2|||Manual Length = 482 Score = 25.0 bits (52), Expect = 6.1 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +1 Query: 157 YYLISIFLKSQKYDALLLQ*SFFLHQRIFFFLLQATLILLQWRKEGNIPL 306 Y LIS+ K Y +Q F + ++A+L + W K+ +IPL Sbjct: 408 YQLISVVKKMINYLQKPVQHEAFFKKYASKKFMKASLFVRDWIKKNSIPL 457 >SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosaccharomyces pombe|chr 2|||Manual Length = 948 Score = 24.6 bits (51), Expect = 8.0 Identities = 11/24 (45%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -2 Query: 326 AFNIE-INNGIFPSFLHCSSINVA 258 +F I+ IN+ I+PS++H S N A Sbjct: 815 SFRIQVINDDIYPSYVHLDSNNYA 838 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,614,103 Number of Sequences: 5004 Number of extensions: 26610 Number of successful extensions: 48 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 188065158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -